Cxcl2 (NM_009140) Mouse Recombinant Protein

CAT#: TP723310

Purified recombinant protein of Mouse chemokine (C-X-C motif) ligand 2 (Cxcl2).

Product Images

Specifications

Product Data

• Species: Mouse
• Expression Host: E. coli
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  AVVASELRCQCLKTLPRVDFKNIQSLSVTPPGPHCAQTEVIATLKGGQKVCLDPEAPLVQKIIQKILNKGKAN
• Tag: Tag Free
• Predicted MW: 7.8 kDa
• Concentration: Resuspend the protein in the desired concentration in proper buffer
• Purity: >95% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: Lyophilized from a 0.2 µM filtered solution of 20mM phosphate buffer,100mM NaCl, pH 7.2
• Bioactivity: Determined by its ability to chemoattract total human neutrophils using a concentration range of 1.0-10.0 ng/ml.
• Endotoxin: Endotoxin level is < 0.1 ng/µg of protein (< 1 EU/µg)
• Storage: Store at -80°C.
• Stability: Stable for at least 6 months from date of receipt under proper storage and handling conditions.

Reference Data

• RefSeq: NP_033166
• Locus ID: 20310
• UniProt ID: P10889, Q3U1J5
• Cytogenetics: 5 44.78 cM
• Refseq Size: 1083
• Refseq ORF: 300
• Synonyms: CINC-2a; Gro2; GROb; Mgsa-b; MIP-2; MIP-2a; Mip2; Scyb; Scyb2
• Summary: Chemotactic for human polymorphonuclear leukocytes but does not induce chemokinesis or an oxidative burst. [UniProtKB/Swiss-Prot Function]