Ccl20 (NM_001159738) Mouse Recombinant Protein

CAT#: TP723314

Purified recombinant protein of Mouse chemokine (C-C motif) ligand 20 (Ccl20), transcript variant 2.

Product Images

Specifications

Product Data

• Species: Mouse
• Expression Host: E. coli
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  ASNYDCCLSYIQTPLPSRAIVGFTRQMADEACDINAIIFHTKKRKSVCADPKQNWVKRAVNLLSLRVKKM
• Tag: Tag Free
• Predicted MW: 7.9 kDa
• Concentration: Resuspend the protein in the desired concentration in proper buffer
• Purity: >95% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: Lyophilized from a 0.2 µM filtered solution of 20mM phosphate buffer,100mM NaCl, pH 7.2
• Bioactivity: Determined by its ability to chemoattract murine CCR6 transfected HEK/293 cells using a concentration range of 0.1-10.0 ng/ml
• Endotoxin: Endotoxin level is < 0.1 ng/µg of protein (< 1 EU/µg)
• Storage: Store at -80°C.
• Stability: Stable for at least 6 months from date of receipt under proper storage and handling conditions.

Reference Data

• RefSeq: NP_001153210
• Locus ID: 20297
• UniProt ID: O89093, Q642U4
• Cytogenetics: 1 42.69 cM
• Refseq Size: 849
• Refseq ORF: 291
• Synonyms: CKb4; exodus-1; LARC; MIP-3A; MIP-3[a]; MIP3A; Scya20; ST38