MMP1 (NM_002421) Human Recombinant Protein
CAT#: TP723319
Purified recombinant protein of Human matrix metallopeptidase 1 (interstitial collagenase) (MMP1), transcript variant 1.
Specifications
Product Data | |
Species | Human |
Expression Host | E. coli |
Expression cDNA Clone or AA Sequence |
MFVLTEGNPRWEQTHLTYRIENYTPDLPRADVDHAIEKAFQLWSNVTPLTFTKVSEGQADIMISFVRGDHRDNSPFDGPGGNLAHAFQPGPGIGGDAHFDEDERWTNNFREYNLHRVAAHELGHSLGLSHSTDIGALMYPSYTFSGDVQLAQDDIDGIQAIYGRSQNPVQPIGPQTPKACDSKLTFDAITTIRGEVMFFKDRFYMRTNPFYPEVELNFISVFWPQLPNGLEAAYEFADRDEVRFFKGNKYWAVQGQNVLHGYPKDIYSSFGFPRTVKHIDAALSEENTGKTYFFVANKYWRYDEYKRSMDPGYPKMIAHDFPGIGHKVDAVFMKDGFFYFFHGTRQYKFDPKTKRILTLQKANSWFNCRKN
|
Tag | Tag Free |
Predicted MW | 42.7 kDa |
Concentration | Resuspend the protein in the desired concentration in proper buffer |
Purity | >90% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | Lyophilized from a 0.2 µM filtered solution of 20mM phosphate buffer,100mM NaCl, pH 7.2 |
Bioactivity | MMP-1 activity was measured by its ability to cleave a chromogenic peptide MMP-1 substrate at room temperature. At an MMP-1 concentration of 2.5 ug/mL, 50% cleavage was achieved at an incubation time of approximately 25 minutes |
Endotoxin | Endotoxin level is < 0.1 ng/µg of protein (< 1 EU/µg) |
Storage | Store at -80°C. |
Stability | Stable for at least 6 months from date of receipt under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_002412 |
Locus ID | 4312 |
UniProt ID | P03956, Q53G95 |
Cytogenetics | 11q22.2 |
Refseq Size | 2081 |
Refseq ORF | 1407 |
Synonyms | CLG; CLGN |
Summary | 'This gene encodes a member of the peptidase M10 family of matrix metalloproteinases (MMPs). Proteins in this family are involved in the breakdown of extracellular matrix in normal physiological processes, such as embryonic development, reproduction, and tissue remodeling, as well as in disease processes, such as arthritis and metastasis. The encoded preproprotein is proteolytically processed to generate the mature protease. This secreted protease breaks down the interstitial collagens, including types I, II, and III. The gene is part of a cluster of MMP genes on chromosome 11. Mutations in this gene are associated with chronic obstructive pulmonary disease (COPD). Alternative splicing results in multiple transcript variants, at least one of which encodes an isoform that is proteolytically processed. [provided by RefSeq, Jan 2016]' |
Protein Families | Druggable Genome, Protease, Secreted Protein |
Protein Pathways | Bladder cancer, Pathways in cancer, PPAR signaling pathway |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC419340 | MMP1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LY419340 | Transient overexpression lysate of matrix metallopeptidase 1 (interstitial collagenase) (MMP1), transcript variant 1 |
USD 325.00 |
|
PH302460 | MMP1 MS Standard C13 and N15-labeled recombinant protein (NP_002412) |
USD 2,055.00 |
|
TP302460 | Recombinant protein of human matrix metallopeptidase 1 (interstitial collagenase) (MMP1), transcript variant 1 |
USD 439.00 |
|
TP720322 | Recombinant protein of human matrix metallopeptidase 1 (interstitial collagenase) (MMP1), transcript variant 1 |
USD 300.00 |
|
TP723882 | Purified recombinant protein of Human matrix metallopeptidase 1 (interstitial collagenase) (MMP1), transcript variant 1 |
USD 270.00 |
|
TP760405 | Purified recombinant protein of Human matrix metallopeptidase 1 (interstitial collagenase) (MMP1), transcript variant 1, with N-terminal HIS tag, expressed in E.Coli, 50ug |
USD 215.00 |
{0} Product Review(s)
Be the first one to submit a review