Myostatin Propeptide (MSTN) (NM_005259) Human Recombinant Protein
CAT#: TP723322
Purified recombinant protein of Human myostatin (MSTN).
Product Images
Specifications
Product Data | |
Species | Human |
Expression Host | E. coli |
Expression cDNA Clone or AA Sequence |
DFGLDCDEHSTESRCCRYPLTVDFEAFGWDWIIAPKRYKANYCSGECEFVFLQKYPHTHLVHQANPRGSAGPCCTPTKMSPINMLYFNGKEQIIYGKIPAMVVDRCGCS
|
Tag | Tag Free |
Predicted MW | 25 kDa |
Concentration | Resuspend the protein in the desired concentration in proper buffer |
Purity | >95% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | Lyophilized from a 0.2 µM filtered solution of 20mM phosphate buffer,100mM NaCl, pH 7.2 |
Bioactivity | Determined by its ability to inhibit the proliferation of MPC-11 cells. The expected ED50 for this effect is 17.0-25.0 ng/ml. |
Endotoxin | Endotoxin level is < 0.1 ng/µg of protein (< 1 EU/µg) |
Storage | Store at -80°C. |
Stability | Stable for at least 6 months from date of receipt under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_005250 |
Locus ID | 2660 |
UniProt ID | O14793, Q53S46 |
Cytogenetics | 2q32.2 |
Refseq Size | 2823 |
Refseq ORF | 1125 |
Synonyms | GDF8; MSLHP |
Summary | 'This gene encodes a secreted ligand of the TGF-beta (transforming growth factor-beta) superfamily of proteins. Ligands of this family bind various TGF-beta receptors leading to recruitment and activation of SMAD family transcription factors that regulate gene expression. The encoded preproprotein is proteolytically processed to generate each subunit of the disulfide-linked homodimer. This protein negatively regulates skeletal muscle cell proliferation and differentiation. Mutations in this gene are associated with increased skeletal muscle mass in humans and other mammals. [provided by RefSeq, Jul 2016]' |
Protein Families | Druggable Genome, Secreted Protein |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC401622 | MSTN HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY401622 | Transient overexpression lysate of myostatin (MSTN) |
USD 396.00 |
|
PH310368 | MSTN MS Standard C13 and N15-labeled recombinant protein (NP_005250) |
USD 2,055.00 |
|
TP310368 | Recombinant protein of human myostatin (MSTN) |
USD 823.00 |
|
TP723323 | Purified recombinant protein of Human myostatin (MSTN). |
USD 240.00 |
{0} Product Review(s)
Be the first one to submit a review