Neuritin (NRN1) (NM_016588) Human Recombinant Protein

CAT#: TP723328

Purified recombinant protein of Human neuritin 1 (NRN1).

Product Images

Specifications

Product Data

• Species: Human
• Expression Host: E. coli
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  AGKCDAVFKGFSDCLLKLGDSMANYPQGLDDKTNIKTVCTYWEDFHSCTVTALTDCQEGAKDMWDKLRKESKNLNIQGSLFELCGSGN
• Tag: Tag Free
• Predicted MW: 9.72 kDa
• Concentration: Resuspend the protein in the desired concentration in proper buffer
• Purity: >95% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: Lyophilized from a 0.2 µM filtered solution of 20mM phosphate buffer,100mM NaCl, pH 7.2
• Bioactivity: Determined by a cell proliferation using rat C6 cells. ED50 for this effect is 20.0-30.0 ng/ml.
• Endotoxin: Endotoxin level is < 0.1 ng/µg of protein (< 1 EU/µg)
• Storage: Store at -80°C.
• Stability: Stable for at least 6 months from date of receipt under proper storage and handling conditions.

Reference Data

• RefSeq: NP_057672
• Locus ID: 51299
• UniProt ID: Q9NPD7
• Cytogenetics: 6p25.1
• Refseq Size: 2072
• Refseq ORF: 426
• Synonyms: dJ380B8.2; NRN
• Summary: This gene encodes a member of the neuritin family, and is expressed in postmitotic-differentiating neurons of the developmental nervous system and neuronal structures associated with plasticity in the adult. The expression of this gene can be induced by neural activity and neurotrophins. The encoded protein contains a consensus cleavage signal found in glycosylphoshatidylinositol (GPI)-anchored proteins. The encoded protein promotes neurite outgrowth and arborization, suggesting its role in promoting neuritogenesis. Overexpression of the encoded protein may be associated with astrocytoma progression. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jul 2013]