Neurotrophin 3 (NTF3) (NM_002527) Human Recombinant Protein
CAT#: TP723338
Purified recombinant protein of Human neurotrophin 3 (NTF3), transcript variant 2.
Specifications
| Product Data | |
| Species | Human |
| Expression Host | E. coli |
| Expression cDNA Clone or AA Sequence |
MYAEHKSHRGEYSVCDSESLWVTDKSSAIDIRGHQVTVLGEIKTGNSPVKQYFYETRCKEARPVKNGCRGIDDKHWNSQCKTSQTYVRALTSENNKLVGWRWIRIDTSCVCALSRKIGRT
|
| Tag | Tag Free |
| Predicted MW | 13.6 kDa |
| Concentration | Resuspend the protein in the desired concentration in proper buffer |
| Purity | >95% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | Lyophilized from a 0.2 µM filtered solution of 20mM phosphate buffer,100mM NaCl, pH 7.2 |
| Bioactivity | The ED50 as determined by the dose-dependent induction of choline acetyl transferase activity in rat basal forebrain primary septal cell cultures was found to be in the range of 20-50 ng/ml. |
| Endotoxin | Endotoxin level is < 0.1 ng/µg of protein (< 1 EU/µg) |
| Storage | Store at -80°C. |
| Stability | Stable for at least 6 months from date of receipt under proper storage and handling conditions. |
| Reference Data | |
| RefSeq | NP_002518 |
| Locus ID | 4908 |
| UniProt ID | P20783 |
| Cytogenetics | 12p13.31 |
| Refseq Size | 1182 |
| Refseq ORF | 771 |
| Synonyms | HDNF; NGF-2; NGF2; NT-3; NT3 |
| Summary | 'The protein encoded by this gene is a member of the neurotrophin family, that controls survival and differentiation of mammalian neurons. This protein is closely related to both nerve growth factor and brain-derived neurotrophic factor. It may be involved in the maintenance of the adult nervous system, and may affect development of neurons in the embryo when it is expressed in human placenta. NTF3-deficient mice generated by gene targeting display severe movement defects of the limbs. The mature peptide of this protein is identical in all mammals examined including human, pig, rat and mouse. [provided by RefSeq, Jul 2008]' |
| Protein Families | Druggable Genome, Secreted Protein |
| Protein Pathways | MAPK signaling pathway, Neurotrophin signaling pathway |
Documents
| FAQs |
Resources
Recombinant Protein Resources |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC419271 | NTF3 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
| LC420181 | NTF3 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
| LY419271 | Transient overexpression lysate of neurotrophin 3 (NTF3), transcript variant 2 |
USD 436.00 |
|
| LY420181 | Transient overexpression lysate of neurotrophin 3 (NTF3), transcript variant 1 |
USD 436.00 |
|
| TP720592 | Purified recombinant protein of Human neurotrophin 3 (NTF3), transcript variant 2 |
USD 330.00 |
|
| TP750019 | Recombinant protein of human Neurotrophin-3 (NT3) produced in E. coli. |
USD 425.00 |
{0} Product Review(s)
Be the first one to submit a review
Germany
Japan
United Kingdom
China