CD252 (TNFSF4) (NM_003326) Human Recombinant Protein

CAT#: TP723346

Purified recombinant protein of Human tumor necrosis factor (ligand) superfamily, member 4 (TNFSF4).

Specifications

Product Data

• Species: Human
• Expression Host: Hi-5 insect
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  QVSHRYPRIQSIKVQFTEYKKEKGFILTSQKEDEIMKVQNNSVIINCDGFYLISLKGYFSQEVNISLHYQKDEEPLFQLKKVRSVNSLMVASLTYKDKVYLNVTTDNTSLDDFHVNGGELILIHQNPGEFCVL
• Tag: Tag Free
• Predicted MW: 15 kDa
• Concentration: Resuspend the protein in the desired concentration in proper buffer
• Purity: >95% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: Lyophilized from a 0.2 µM filtered solution of 20mM phosphate buffer,100mM NaCl, pH 7.2
• Bioactivity: Determined by its ability to stimulate IL-8 production by human PBMC using a concentration range of 30-100 ng/ml. Note: Results may vary with PBMC donors.
• Endotoxin: Endotoxin level is < 0.1 ng/µg of protein (< 1 EU/µg)
• Storage: Store at -80°C.
• Stability: Stable for at least 6 months from date of receipt under proper storage and handling conditions.

Reference Data

• RefSeq: NP_003317
• Locus ID: 7292
• UniProt ID: P23510, A0A024R937
• Cytogenetics: 1q25.1
• Refseq Size: 3510
• Refseq ORF: 549
• Synonyms: CD134L; CD252; GP34; OX-40L; OX4OL; TNLG2B; TXGP1
• Summary: 'This gene encodes a cytokine of the tumor necrosis factor (TNF) ligand family. The encoded protein functions in T cell antigen-presenting cell (APC) interactions and mediates adhesion of activated T cells to endothelial cells. Polymorphisms in this gene have been associated with Sjogren's syndrome and systemic lupus erythematosus. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jul 2014]'
• Protein Families: Druggable Genome, Transmembrane
• Protein Pathways: Cytokine-cytokine receptor interaction