CD252 (TNFSF4) (NM_003326) Human Recombinant Protein
CAT#: TP723346
Purified recombinant protein of Human tumor necrosis factor (ligand) superfamily, member 4 (TNFSF4).
Product Images
Specifications
Product Data | |
Species | Human |
Expression Host | Hi-5 insect |
Expression cDNA Clone or AA Sequence |
QVSHRYPRIQSIKVQFTEYKKEKGFILTSQKEDEIMKVQNNSVIINCDGFYLISLKGYFSQEVNISLHYQKDEEPLFQLKKVRSVNSLMVASLTYKDKVYLNVTTDNTSLDDFHVNGGELILIHQNPGEFCVL
|
Tag | Tag Free |
Predicted MW | 15 kDa |
Concentration | Resuspend the protein in the desired concentration in proper buffer |
Purity | >95% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | Lyophilized from a 0.2 µM filtered solution of 20mM phosphate buffer,100mM NaCl, pH 7.2 |
Bioactivity | Determined by its ability to stimulate IL-8 production by human PBMC using a concentration range of 30-100 ng/ml. Note: Results may vary with PBMC donors. |
Endotoxin | Endotoxin level is < 0.1 ng/µg of protein (< 1 EU/µg) |
Storage | Store at -80°C. |
Stability | Stable for at least 6 months from date of receipt under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_003317 |
Locus ID | 7292 |
UniProt ID | P23510, A0A024R937 |
Cytogenetics | 1q25.1 |
Refseq Size | 3510 |
Refseq ORF | 549 |
Synonyms | CD134L; CD252; GP34; OX-40L; OX4OL; TNLG2B; TXGP1 |
Summary | 'This gene encodes a cytokine of the tumor necrosis factor (TNF) ligand family. The encoded protein functions in T cell antigen-presenting cell (APC) interactions and mediates adhesion of activated T cells to endothelial cells. Polymorphisms in this gene have been associated with Sjogren's syndrome and systemic lupus erythematosus. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jul 2014]' |
Protein Families | Druggable Genome, Transmembrane |
Protein Pathways | Cytokine-cytokine receptor interaction |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC401143 | TNFSF4 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LY401143 | Transient overexpression lysate of tumor necrosis factor (ligand) superfamily, member 4 (TNFSF4) |
USD 325.00 |
|
PH324021 | TNFSF4 MS Standard C13 and N15-labeled recombinant protein (NP_003317) |
USD 2,055.00 |
|
TP324021 | Recombinant protein of human tumor necrosis factor (ligand) superfamily, member 4 (TNFSF4) |
USD 748.00 |
|
TP700285 | Purified recombinant protein of human tumor necrosis factor (ligand) superfamily, member 4 (TNFSF4), with C-terminal Fc tag, expressed in human cells, 20 µg |
USD 748.00 |
{0} Product Review(s)
Be the first one to submit a review