p16INK4A (CDKN2A) (NM_000077) Human Recombinant Protein
CAT#: TP723347
Purified recombinant protein of Human cyclin-dependent kinase inhibitor 2A (melanoma, p16, inhibits CDK4) (CDKN2A), transcript variant 1.
Specifications
Product Data | |
Species | Human |
Expression Host | E. coli |
Expression cDNA Clone or AA Sequence |
MEPAAGSSMEPSADWLATAAARGRVEEVRALLEAGALPNAPNSYGRRPIQVMMMGSARVAELLLLHGAEPNCADPATLTRPVHDAAREGFLDTLVVLHRAGARLDVRDAWGRLPVDLAEELGHRDVARYLRAAAGGTRGSNHARIDAAEGPSDIPD
|
Tag | Tag Free |
Predicted MW | 16.5 kDa |
Concentration | Resuspend the protein in the desired concentration in proper buffer |
Purity | >95% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | Lyophilized from a 0.2 µM filtered solution of 20mM phosphate buffer,100mM NaCl, pH 7.2 |
Endotoxin | Endotoxin level is < 0.1 ng/µg of protein (< 1 EU/µg) |
Storage | Store at -80°C. |
Stability | Stable for at least 6 months from date of receipt under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_000068 |
Locus ID | 1029 |
UniProt ID | P42771, K7PML8 |
Cytogenetics | 9p21.3 |
Refseq Size | 1163 |
Refseq ORF | 468 |
Synonyms | ARF; CDK4I; CDKN2; CMM2; INK4; INK4A; MLM; MTS-1; MTS1; P14; P14ARF; P16; P16-INK4A; P16INK4; P16INK4A; P19; P19ARF; TP16 |
Summary | 'This gene generates several transcript variants which differ in their first exons. At least three alternatively spliced variants encoding distinct proteins have been reported, two of which encode structurally related isoforms known to function as inhibitors of CDK4 kinase. The remaining transcript includes an alternate first exon located 20 Kb upstream of the remainder of the gene; this transcript contains an alternate open reading frame (ARF) that specifies a protein which is structurally unrelated to the products of the other variants. This ARF product functions as a stabilizer of the tumor suppressor protein p53 as it can interact with, and sequester, the E3 ubiquitin-protein ligase MDM2, a protein responsible for the degradation of p53. In spite of the structural and functional differences, the CDK inhibitor isoforms and the ARF product encoded by this gene, through the regulatory roles of CDK4 and p53 in cell cycle G1 progression, share a common functionality in cell cycle G1 control. This gene is frequently mutated or deleted in a wide variety of tumors, and is known to be an important tumor suppressor gene. [provided by RefSeq, Sep 2012]' |
Protein Families | Druggable Genome |
Protein Pathways | Bladder cancer, Cell cycle, Chronic myeloid leukemia, Glioma, Melanoma, Non-small cell lung cancer, p53 signaling pathway, Pancreatic cancer, Pathways in cancer |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC400022 | CDKN2A HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LC409229 | CDKN2A HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LC429923 | CDKN2A HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LC434008 | CDKN2A HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LY400022 | Transient overexpression lysate of cyclin-dependent kinase inhibitor 2A (melanoma, p16, inhibits CDK4) (CDKN2A), transcript variant 1 |
USD 325.00 |
|
LY409229 | Transient overexpression lysate of cyclin-dependent kinase inhibitor 2A (melanoma, p16, inhibits CDK4) (CDKN2A), transcript variant 4 |
USD 325.00 |
|
LY429923 | Transient overexpression lysate of cyclin-dependent kinase inhibitor 2A (melanoma, p16, inhibits CDK4) (CDKN2A), transcript variant 4 |
USD 325.00 |
|
LY434008 | Transient overexpression lysate of cyclin-dependent kinase inhibitor 2A (melanoma, p16, inhibits CDK4) (CDKN2A), transcript variant 5 |
USD 325.00 |
|
PH320937 | CDKN2A MS Standard C13 and N15-labeled recombinant protein (NP_000068) |
USD 2,055.00 |
|
TP320937 | Recombinant protein of human cyclin-dependent kinase inhibitor 2A (melanoma, p16, inhibits CDK4) (CDKN2A), transcript variant 1 |
USD 748.00 |
|
TP723348 | Purified recombinant protein of Human cyclin-dependent kinase inhibitor 2A (melanoma, p16, inhibits CDK4) (CDKN2A), transcript variant 1. |
USD 240.00 |
|
TP762226 | Purified recombinant protein of Human cyclin-depEndent kinase inhibitor 2A (melanoma, p16, inhibits CDK4) (CDKN2A), transcript variant 4, Met42-End, with N-terminal His tag, expressed in E.coli, 50ug |
USD 205.00 |
{0} Product Review(s)
Be the first one to submit a review