PDGF AA (PDGFA) (NM_002607) Human Recombinant Protein
CAT#: TP723352
Purified recombinant protein of Human platelet-derived growth factor alpha polypeptide (PDGFA), transcript variant 1.
Product Images
Specifications
Product Data | |
Species | Human |
Expression Host | E. coli |
Expression cDNA Clone or AA Sequence |
SIEEAVPAVCKTRTVIYEIPRSQVDPTSANFLIWPPCVEVKRCTGCCNTSSVKCQPSRVHHRSVKVAKVEYVRKKPKLKEVQVRLEEHLECACATTSLNPDYREEDTGRPRESGKKRKRKRLKPT
|
Tag | Tag Free |
Predicted MW | 28.5 kDa |
Concentration | Resuspend the protein in the desired concentration in proper buffer |
Purity | >95% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | Lyophilized from a 0.2 µM filtered solution of 20mM phosphate buffer,100mM NaCl, pH 7.2 |
Bioactivity | ED50 as determined by the dose-dependent stimulation of thymidine uptake by Balb/c 3T3 cells is less than or equal to 1 ng/ml, corresponding to a specific activity of > 1 x 10^6 units/mg. |
Endotoxin | Endotoxin level is < 0.1 ng/µg of protein (< 1 EU/µg) |
Storage | Store at -80°C. |
Stability | Stable for at least 6 months from date of receipt under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_002598 |
Locus ID | 5154 |
UniProt ID | P04085 |
Cytogenetics | 7p22.3 |
Refseq Size | 2818 |
Refseq ORF | 633 |
Synonyms | PDGF-A; PDGF1 |
Summary | 'This gene encodes a member of the protein family comprised of both platelet-derived growth factors (PDGF) and vascular endothelial growth factors (VEGF). The encoded preproprotein is proteolytically processed to generate platelet-derived growth factor subunit A, which can homodimerize, or alternatively, heterodimerize with the related platelet-derived growth factor subunit B. These proteins bind and activate PDGF receptor tyrosine kinases, which play a role in a wide range of developmental processes. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Oct 2015]' |
Protein Families | Druggable Genome |
Protein Pathways | Cytokine-cytokine receptor interaction, Focal adhesion, Gap junction, Glioma, MAPK signaling pathway, Melanoma, Pathways in cancer, Prostate cancer, Regulation of actin cytoskeleton |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC409784 | PDGFA HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC419225 | PDGFA HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC429844 | PDGFA HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY409784 | Transient overexpression lysate of platelet-derived growth factor alpha polypeptide (PDGFA), transcript variant 2 |
USD 396.00 |
|
LY419225 | Transient overexpression lysate of platelet-derived growth factor alpha polypeptide (PDGFA), transcript variant 1 |
USD 396.00 |
|
LY429844 | Transient overexpression lysate of platelet-derived growth factor alpha polypeptide (PDGFA), transcript variant 2 |
USD 396.00 |
|
PH314164 | PDGFA MS Standard C13 and N15-labeled recombinant protein (NP_148983) |
USD 2,055.00 |
|
TP314164 | Purified recombinant protein of Homo sapiens platelet-derived growth factor alpha polypeptide (PDGFA), transcript variant 2 |
USD 399.00 |
|
TP721178 | Purified recombinant protein of Human platelet-derived growth factor alpha polypeptide (PDGFA), transcript variant 2 |
USD 330.00 |
|
TP721210 | Purified recombinant protein of Human platelet-derived growth factor alpha polypeptide (PDGFA), transcript variant 2 |
USD 330.00 |
{0} Product Review(s)
Be the first one to submit a review