PDGF beta (PDGFB) (NM_002608) Human Recombinant Protein
CAT#: TP723355
Purified recombinant protein of Human platelet-derived growth factor beta polypeptide (PDGFB), transcript variant 1.
Product Images
Specifications
| Product Data | |
| Species | Human |
| Expression Host | E. coli |
| Expression cDNA Clone or AA Sequence |
SLGSLTIAEPAMIAECKTRTEVFEISRRLIDRTNANFLVWPPCVEVQRCSGCCNNRNVQCRPTQVQLRPVQVRKIEIVRKKPIFKKATVTLEDHLACKCETVAAARPVT
|
| Tag | Tag Free |
| Predicted MW | 24.3 kDa |
| Concentration | Resuspend the protein in the desired concentration in proper buffer |
| Purity | >95% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | Lyophilized from a 0.2 µM filtered solution of 20mM phosphate buffer,100mM NaCl, pH 7.2 |
| Bioactivity | Determined by the dose-dependent stimulation of the proliferation of Balb/c 3T3 cells.The expected ED50 for this effect is 1.0-3.0 ng/ml. |
| Endotoxin | Endotoxin level is < 0.1 ng/µg of protein (< 1 EU/µg) |
| Storage | Store at -80°C. |
| Stability | Stable for at least 6 months from date of receipt under proper storage and handling conditions. |
| Reference Data | |
| RefSeq | NP_002599 |
| Locus ID | 5155 |
| UniProt ID | P01127, A0A384NYY3 |
| Cytogenetics | 22q13.1 |
| Refseq Size | 3393 |
| Refseq ORF | 723 |
| Synonyms | c-sis; IBGC5; PDGF-2; PDGF2; SIS; SSV |
| Summary | 'This gene encodes a member of the protein family comprised of both platelet-derived growth factors (PDGF) and vascular endothelial growth factors (VEGF). The encoded preproprotein is proteolytically processed to generate platelet-derived growth factor subunit B, which can homodimerize, or alternatively, heterodimerize with the related platelet-derived growth factor subunit A. These proteins bind and activate PDGF receptor tyrosine kinases, which play a role in a wide range of developmental processes. Mutations in this gene are associated with meningioma. Reciprocal translocations between chromosomes 22 and 17, at sites where this gene and that for collagen type 1, alpha 1 are located, are associated with dermatofibrosarcoma protuberans, a rare skin tumor. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Oct 2015]' |
| Protein Families | Druggable Genome |
| Protein Pathways | Cytokine-cytokine receptor interaction, Focal adhesion, Gap junction, Glioma, MAPK signaling pathway, Melanoma, Pathways in cancer, Prostate cancer, Regulation of actin cytoskeleton, Renal cell carcinoma |
Documents
| FAQs |
Resources
Recombinant Protein Resources |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC400920 | PDGFB HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
| LC409779 | PDGFB HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
| LY400920 | Transient overexpression lysate of platelet-derived growth factor beta polypeptide (simian sarcoma viral (v-sis) oncogene homolog) (PDGFB), transcript variant 1 |
USD 436.00 |
|
| LY409779 | Transient overexpression lysate of platelet-derived growth factor beta polypeptide (simian sarcoma viral (v-sis) oncogene homolog) (PDGFB), transcript variant 2 |
USD 436.00 |
|
| TP720176 | Recombinant protein of human platelet-derived growth factor beta polypeptide (simian sarcoma viral (v-sis) oncogene homolog) (PDGFB), transcript variant 1 |
USD 330.00 |
|
| TP760506 | Purified recombinant protein of Human platelet-derived growth factor beta polypeptide (PDGFB), transcript variant 1, full length, with N-terminal HIS tag, expressed in E.Coli, 50ug |
USD 215.00 |
{0} Product Review(s)
Be the first one to submit a review
Germany
Japan
United Kingdom
China