PLGF (PGF) (NM_002632) Human Recombinant Protein
CAT#: TP723367
Purified recombinant protein of Human placental growth factor (PGF), transcript variant 1.
Specifications
| Product Data | |
| Species | Human |
| Expression Host | E. coli |
| Expression cDNA Clone or AA Sequence |
LPAVPPQQWALSAGNGSSEVEVVPFQEVWGRSYCRALERLVDVVSEYPSEVEHMFSPSCVSLLRCTGCCGDENLHCVPVETANVTMQLLKIRSGDRPSYVELTFSQHVRCECRHSPGRQSPDMPGDFRADAPSFLPPRRSLPMLFRMEWGCALTGSQSAVWPSSPVPEEIPRMHPGRNGKKQQRKPLREKMKPERCGDAVPRR
|
| Tag | Tag Free |
| Predicted MW | 45.7 kDa |
| Concentration | Resuspend the protein in the desired concentration in proper buffer |
| Purity | >95% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | Lyophilized from a 0.2 µM filtered solution of 20mM phosphate buffer,100mM NaCl, pH 7.2 |
| Bioactivity | Determined by its ability to chemoattract human monocytes using a concentration range of 5.0-50.0 ng/ml. |
| Endotoxin | Endotoxin level is < 0.1 ng/µg of protein (< 1 EU/µg) |
| Storage | Store at -80°C. |
| Stability | Stable for at least 6 months from date of receipt under proper storage and handling conditions. |
| Reference Data | |
| RefSeq | NP_002623 |
| Locus ID | 5228 |
| UniProt ID | P49763, Q53XY6, Q86TW6 |
| Cytogenetics | 14q24.3 |
| Refseq Size | 1758 |
| Refseq ORF | 510 |
| Synonyms | D12S1900; PGFL; PIGF; PLGF; PlGF-2; SHGC-10760 |
| Summary | 'This gene encodes a growth factor found in placenta which is homologous to vascular endothelial growth factor. Alternatively spliced transcripts encoding different isoforms have been found for this gene.[provided by RefSeq, Jun 2011]' |
| Protein Families | Druggable Genome, Secreted Protein |
| Protein Pathways | Bladder cancer, Focal adhesion, mTOR signaling pathway, Pancreatic cancer, Pathways in cancer, Renal cell carcinoma |
Documents
| FAQs |
Resources
Recombinant Protein Resources |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC419203 | PGF HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
| LY419203 | Transient overexpression lysate of placental growth factor (PGF) |
USD 436.00 |
|
| TP300443 | Purified recombinant protein of Human placental growth factor (PGF), full length, with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug |
USD 748.00 |
|
| TP723365 | Purified recombinant protein of Human placental growth factor (PGF), transcript variant 1. |
USD 240.00 |
|
| TP723366 | Purified recombinant protein of Human placental growth factor (PGF), transcript variant 1. |
USD 240.00 |
|
| TP723864 | Purified recombinant protein of Human placental growth factor (PGF / PLGF-1), transcript variant 1 |
USD 190.00 |
{0} Product Review(s)
Be the first one to submit a review
Germany
Japan
United Kingdom
China