Ccl5 (NM_013653) Mouse Recombinant Protein

CAT#: TP723374

Purified recombinant protein of Mouse chemokine (C-C motif) ligand 5 (Ccl5).

Product Images

Specifications

Product Data

• Species: Mouse
• Expression Host: E. coli
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  SPYGSDTTPCCFAYLSLALPRAHVKEYFYTSSKCSNLAVVFVTRRNRQVCANPEKKWVQEYINYLEMS
• Tag: Tag Free
• Predicted MW: 7.8 kDa
• Concentration: Resuspend the protein in the desired concentration in proper buffer
• Purity: >95% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: Lyophilized from a 0.2 µM filtered solution of 20mM phosphate buffer,100mM NaCl, pH 7.2
• Bioactivity: Determined by its ability to chemoattract total human lymphocyte population and total murine T cell population using a concentration range of 1.0-10.0 ng/ml.
• Endotoxin: Endotoxin level is < 0.1 ng/µg of protein (< 1 EU/µg)
• Storage: Store at -80°C.
• Stability: Stable for at least 6 months from date of receipt under proper storage and handling conditions.

Reference Data

• RefSeq: NP_038681
• Locus ID: 20304
• UniProt ID: P30882, Q5XZF2
• Cytogenetics: 11 50.66 cM
• Refseq Size: 579
• Refseq ORF: 273
• Synonyms: MuRantes; RANTES; Scya5; SISd; TCP228