Retnlg (NM_181596) Mouse Recombinant Protein

CAT#: TP723381

Purified recombinant protein of Mouse resistin like gamma (Retnlg).


USD 240.00

5 Days*

Size
    • 25 ug

Product Images

Other products for "Retnlg"

Specifications

Product Data
Species Mouse
Expression Host E. coli
Expression cDNA Clone or AA Sequence
EGTLESIVEKKVKELLANRDDCPSTVTKTFSCTSITASGRLASCPSGMTVTGCACGYGCGSWDIRDGNTCHCQCSTMDWATARCCQLA
Tag Tag Free
Predicted MW 9.2 kDa
Concentration Resuspend the protein in the desired concentration in proper buffer
Purity >95% as determined by SDS-PAGE and Coomassie blue staining
Buffer Lyophilized from a 0.2 µM filtered solution of 20mM phosphate buffer,100mM NaCl, pH 7.2
Endotoxin Endotoxin level is < 0.1 ng/µg of protein (< 1 EU/µg)
Storage Store at -80°C.
Stability Stable for at least 6 months from date of receipt under proper storage and handling conditions.
Reference Data
RefSeq NP_853627
Locus ID 245195
UniProt ID Q8K426
Cytogenetics 16 30.75 cM
Refseq Size 610
Refseq ORF 351
Synonyms Fizz3; Relmg; Xcp1

Documents

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.