CD22 (NM_001771) Human Recombinant Protein
CAT#: TP723390
Purified recombinant protein of Human CD22 molecule (CD22), transcript variant 1.
Specifications
Product Data | |
Species | Human |
Expression Host | CHO |
Expression cDNA Clone or AA Sequence |
SKWVFEHPETLYAWEGACVWIPCTYRALDGDLESFILFHNPEYNKNTSKFDGTRLYESTKDGKVPSEQKRVQFLGDKNKNCTLSIHPVHLNDSGQLGLRMESKTEKWMERIHLNVSERPFPPHIQLPPEIQESQEVTLTCLLNFSCYGYPIQLQWLLEGVPMRQAAVTSTSLTIKSVFTRSELKFSPQWSHHGKIVTCQLQDADGKFLSNDTVQLNVKHTPKLEIKVTPSDAIVREGDSVTMTCEVSSSNPEYTTVSWLKDGTSLKKQNTFTLNLREVTKDQSGKYCCQVSNDVGPGRSEEVFLQVQYAPEPSTVQILHSPAVEGSQVEFLCMSLANPLPTNYTWYHNGKEMQGRTEEKVHIPKILPWHAGTYSCVAENILGTGQRGPGAELDVQYPPKKVTTVIQNPMPIREGDTVTLSCNYNSSNPSVTRYEWKPHGAWEEPSLGVLKIQNVGWDNTTIACARCNSWCSWASPVALNVQYAPRDVRVRKIKPLSEIHSGNSVSLQCDFSSSHPKEVQFFWEKNGRLLGKESQLNFDSISPEDAGSYSCWVNNSIGQTASKAWTLEVLYAPRRLRVSMSPGDQVMEGKSATLTCESDANPPVSHYTWFDWNNQSLPHHSQKLRLEPVKVQHSGAYWCQGTNSVGKGRSPLSTLTVYYSPETIGRR
|
Tag | Tag Free |
Predicted MW | 75 kDa |
Concentration | Resuspend the protein in the desired concentration in proper buffer |
Purity | >95% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | Lyophilized from a 0.2 µM filtered solution of 20mM phosphate buffer,100mM NaCl, pH 7.2 |
Bioactivity | Determined by its ability to inhibit the proliferation of Raji cells. The expected ED50 for this effect is 10-17ug/mL. |
Endotoxin | Endotoxin level is < 0.1 ng/µg of protein (< 1 EU/µg) |
Storage | Store at -80°C. |
Stability | Stable for at least 6 months from date of receipt under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_001762 |
Locus ID | 933 |
UniProt ID | P20273, Q0EAF5 |
Cytogenetics | 19q13.12 |
Refseq Size | 3300 |
Refseq ORF | 2541 |
Synonyms | SIGLEC-2; SIGLEC2 |
Summary | '' |
Protein Families | Druggable Genome, Transmembrane |
Protein Pathways | B cell receptor signaling pathway, Cell adhesion molecules (CAMs), Hematopoietic cell lineage |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC434364 | CD22 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 155.00 |
|
LY434364 | Transient overexpression lysate of CD22 molecule (CD22), transcript variant 4 |
USD 495.00 |
|
PH316939 | CD22 MS Standard C13 and N15-labeled recombinant protein (NP_001762) |
USD 2,055.00 |
|
TP316939 | Recombinant protein of human CD22 molecule (CD22) |
USD 788.00 |
{0} Product Review(s)
Be the first one to submit a review