CD23 (FCER2) (NM_002002) Human Recombinant Protein

CAT#: TP723391

Purified recombinant protein of Human Fc fragment of IgE, low affinity II, receptor for (CD23) (FCER2), transcript variant 1.

Product Images

Specifications

Product Data

• Species: Human
• Expression Host: E. coli
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  MELQVSSGFVCNTCPEKWINFQRKCYYFGKGTKQWVHARYACDDMEGQLVSIHSPEEQDFLTKHASHTGSWIGLRNLDLKGEFIWVDGSHVDYSNWAPGEPTSRSQGEDCVMMRGSGRWNDAFCDRKLGAWVCDRLATCTPPASEGSAESMGPDSRPDPDGRLPTPSAPLHS
• Tag: Tag Free
• Predicted MW: 19.2 kDa
• Concentration: Resuspend the protein in the desired concentration in proper buffer
• Purity: >95% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: Lyophilized from a 0.2 µM filtered solution of 20mM phosphate buffer,100mM NaCl, pH 7.2
• Bioactivity: Measured by its ability to induce TNF-alpha production by human PBMCs.
• Endotoxin: Endotoxin level is < 0.1 ng/µg of protein (< 1 EU/µg)
• Storage: Store at -80°C.
• Stability: Stable for at least 6 months from date of receipt under proper storage and handling conditions.

Reference Data

• RefSeq: NP_001993
• Locus ID: 2208
• UniProt ID: P06734
• Cytogenetics: 19p13.2
• Refseq Size: 1620
• Refseq ORF: 963
• Synonyms: BLAST-2; CD23; CD23A; CLEC4J; FCE2; IGEBF
• Summary: 'The protein encoded by this gene is a B-cell specific antigen, and a low-affinity receptor for IgE. It has essential roles in B cell growth and differentiation, and the regulation of IgE production. This protein also exists as a soluble secreted form, then functioning as a potent mitogenic growth factor. Alternatively spliced transcript variants encoding different isoforms have been described for this gene.[provided by RefSeq, Jul 2011]'
• Protein Families: Secreted Protein, Transmembrane
• Protein Pathways: Hematopoietic cell lineage