CD34 (NM_001025109) Human Recombinant Protein
CAT#: TP723394
Purified recombinant protein of Human CD34 molecule (CD34), transcript variant 1.
Product Images
Specifications
Product Data | |
Species | Human |
Expression Host | CHO |
Expression cDNA Clone or AA Sequence |
LDNNGTATPELPTQGTFSNVSTNVSYQETTTPSTLGSTSLHPVSQHGNEATTNITETTVKFTSTSVITSVYGNTNSSVQSQTSVISTVFTTPANVSTPETTLKPSLSPGNVSDLSTTSTSLATSPTKPYTSSSPILSDIKAEIKCSGIREVKLTQGICLEQNKTSSCAEFKKDRGEGLARVLCGEEQADADAGAQVCSLLLAQSEVRPQCLLLVLANRTEISSKLQLMKKHQSDLKKLGILDFTEQDVASHQSYSQKT
|
Tag | Tag Free |
Predicted MW | 27 kDa |
Concentration | Resuspend the protein in the desired concentration in proper buffer |
Purity | >95% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | Lyophilized from a 0.2 µM filtered solution of 20mM phosphate buffer,100mM NaCl, pH 7.2 |
Endotoxin | Endotoxin level is < 0.1 ng/µg of protein (< 1 EU/µg) |
Storage | Store at -80°C. |
Stability | Stable for at least 6 months from date of receipt under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_001020280 |
Locus ID | 947 |
UniProt ID | P28906 |
Cytogenetics | 1q32.2 |
Refseq Size | 2621 |
Refseq ORF | 1155 |
Summary | 'The protein encoded by this gene may play a role in the attachment of stem cells to the bone marrow extracellular matrix or to stromal cells. This single-pass membrane protein is highly glycosylated and phosphorylated by protein kinase C. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Aug 2011]' |
Protein Families | Adult stem cells, Cancer stem cells, Druggable Genome, Embryonic stem cells, ES Cell Differentiation/IPS, Transmembrane |
Protein Pathways | Cell adhesion molecules (CAMs), Hematopoietic cell lineage |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC400668 | CD34 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LC422593 | CD34 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LC429079 | CD34 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LY400668 | Transient overexpression lysate of CD34 molecule (CD34), transcript variant 2 |
USD 325.00 |
|
LY422593 | Transient overexpression lysate of CD34 molecule (CD34), transcript variant 1 |
USD 325.00 |
|
LY429079 | Transient overexpression lysate of CD34 molecule (CD34), transcript variant 2 |
USD 325.00 |
|
PH304446 | CD34 MS Standard C13 and N15-labeled recombinant protein (NP_001020280) |
USD 2,055.00 |
|
TP304446 | Recombinant protein of human CD34 molecule (CD34), transcript variant 1 |
USD 439.00 |
|
TP700209 | Recombinant protein of human CD34 molecule (CD34), transcript variant 2, extracellular domain with C-terminal Fc fusion, expressed in human cells, 20 µg |
USD 748.00 |
{0} Product Review(s)
Be the first one to submit a review