Kitl (NM_013598) Mouse Recombinant Protein
CAT#: TP723398
Purified recombinant protein of Mouse kit ligand (Kitl).
Other products for "Kitl"
Specifications
| Product Data | |
| Species | Mouse |
| Expression Host | E. coli |
| Expression cDNA Clone or AA Sequence |
MKEICGNPVTDNVKDITKLVANLPNDYMITLNYVAGMDVLPSHCWLRDMVIQLSLSLTTLLDKFSNISEGLSNYSIIDKLGKIVDDLVLCMEENAPKNIKESPKRPETRSFTPEEFFSIFNRSIDAFKDFMVASDTSDCVLSSTLGPEKDSRVSVTKPFMLPPVA
|
| Tag | Tag Free |
| Predicted MW | 18.3 kDa |
| Concentration | Resuspend the protein in the desired concentration in proper buffer |
| Purity | >95% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | Lyophilized from a 0.2 µM filtered solution of 20mM phosphate buffer,100mM NaCl, pH 7.2 |
| Bioactivity | The ED50 as determined by the dose-dependent stimulation of the proliferation of the human TF-1 cells is > 10 ng/ml, corresponding to a specific activity of > 1 x 10^5 units/mg. |
| Endotoxin | Endotoxin level is < 0.1 ng/µg of protein (< 1 EU/µg) |
| Storage | Store at -80°C. |
| Stability | Stable for at least 6 months from date of receipt under proper storage and handling conditions. |
| Reference Data | |
| RefSeq | NP_038626 |
| Locus ID | 17311 |
| UniProt ID | P20826 |
| Cytogenetics | 10 51.4 cM |
| Refseq Size | 5449 |
| Refseq ORF | 819 |
| Synonyms | blz; Clo; Con; contrasted; Gb; Kitlg; Mgf; SCF; SF; Sl; SLF |
| Summary | Ligand for the receptor-type protein-tyrosine kinase KIT. Plays an essential role in the regulation of cell survival and proliferation, hematopoiesis, stem cell maintenance, gametogenesis, mast cell development, migration and function, and in melanogenesis. KITLG/SCF binding can activate several signaling pathways. Promotes phosphorylation of PIK3R1, the regulatory subunit of phosphatidylinositol 3-kinase, and subsequent activation of the kinase AKT1. KITLG/SCF and KIT also transmit signals via GRB2 and activation of RAS, RAF1 and the MAP kinases MAPK1/ERK2 and/or MAPK3/ERK1. KITLG/SCF and KIT promote activation of STAT family members STAT1, STAT3 and STAT5. KITLG/SCF and KIT promote activation of PLCG1, leading to the production of the cellular signaling molecules diacylglycerol and inositol 1,4,5-trisphosphate. KITLG/SCF acts synergistically with other cytokines, probably interleukins. [UniProtKB/Swiss-Prot Function] |
Documents
| FAQs |
Resources
Recombinant Protein Resources |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| TP723775 | Purified recombinant protein of Mouse kit ligand (Kitl / SCF ) |
USD 255.00 |
{0} Product Review(s)
0 Product Review(s)
Submit review
Be the first one to submit a review
Product Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.
Germany
Japan
United Kingdom
China