Fas Ligand (FASLG) (NM_000639) Human Recombinant Protein
CAT#: TP723410
Purified recombinant protein of Human Fas ligand (TNF superfamily, member 6) (FASLG).
Product Images
![](https://cdn.origene.com/img/defaults-img.jpg)
Specifications
Product Data | |
Species | Human |
Expression Host | CHO |
Expression cDNA Clone or AA Sequence |
HHHHHHHHPSPPPEKKELRKVAHLTGKSNSRSMPLEWEDTYGIVLLSGVKYKKGGLVINETGLYFVYSKVYFRGQSCNNLPLSHKVYMRNSKYPQDLVMMEGKMMSYCTTGQMWARSSYLGAVFNLTSADHLYVNVSELSLVNFEESQTFFGLYKL
|
Tag | N-His |
Predicted MW | 17.9 kDa |
Concentration | Resuspend the protein in the desired concentration in proper buffer |
Purity | >95% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | Lyophilized from a 0.2 µM filtered solution of 20mM phosphate buffer,100mM NaCl, pH 7.2 |
Bioactivity | Determined by it's ability to induce cytotoxicity in Jurkat cells in the absence of any cross-linking. ED50 for this effect is less than or equal to 10.0 ng/ml, corresponding to a specific activity of > 1 x 10^5 units/mg. |
Endotoxin | Endotoxin level is < 0.1 ng/µg of protein (< 1 EU/µg) |
Storage | Store at -80°C. |
Stability | Stable for at least 6 months from date of receipt under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_000630 |
Locus ID | 356 |
UniProt ID | P48023, Q53ZZ1 |
Cytogenetics | 1q24.3 |
Refseq Size | 1909 |
Refseq ORF | 843 |
Synonyms | ALPS1B; APT1LG1; APTL; CD95-L; CD95L; CD178; FASL; TNFSF6; TNLG1A |
Summary | 'This gene is a member of the tumor necrosis factor superfamily. The primary function of the encoded transmembrane protein is the induction of apoptosis triggered by binding to FAS. The FAS/FASLG signaling pathway is essential for immune system regulation, including activation-induced cell death (AICD) of T cells and cytotoxic T lymphocyte induced cell death. It has also been implicated in the progression of several cancers. Defects in this gene may be related to some cases of systemic lupus erythematosus (SLE). Alternatively spliced transcript variants have been described. [provided by RefSeq, Nov 2014]' |
Protein Families | Druggable Genome, Secreted Protein, Transmembrane |
Protein Pathways | Allograft rejection, Apoptosis, Autoimmune thyroid disease, Cytokine-cytokine receptor interaction, Graft-versus-host disease, MAPK signaling pathway, Natural killer cell mediated cytotoxicity, Neurotrophin signaling pathway, Pathways in cancer, Type I diabetes mellitus |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC400216 | FASLG HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY400216 | Transient overexpression lysate of Fas ligand (TNF superfamily, member 6) (FASLG) |
USD 396.00 |
|
TP723853 | Purified recombinant protein of Human Fas ligand (TNF superfamily, member 6) (FASLG / TNFSF6) |
USD 255.00 |
{0} Product Review(s)
Be the first one to submit a review