TNFRSF1B (NM_001066) Human Recombinant Protein

CAT#: TP723428

Purified recombinant protein of Human tumor necrosis factor receptor superfamily, member 1B (TNFRSF1B).

Product Images

Specifications

Product Data

• Species: Human
• Expression Host: E. coli
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  MAPEPGSTCRLREYYDQTAQMCCSKCSPGQHAKVFCTKTSDTVCDSCEDSTYTQLWNWVPECLSCGSRCSSDQVETQACTREQNRICTCRPGWYCALSKQEGCRLCAPLRKCRPGFGVARPGTETSDVVCKPCAPGTFSNTTSSTDICRPHQICNVVAIPGNASMDAVCTSTSP
• Tag: Tag Free
• Predicted MW: 18.9 kDa
• Concentration: Resuspend the protein in the desired concentration in proper buffer
• Purity: >95% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: Lyophilized from a 0.2 µM filtered solution of 20mM phosphate buffer,100mM NaCl, pH 7.2
• Bioactivity: Determined by its inhibitory effect of the TNF-alpha; mediated cytotoxicity in murine L-929 cells. ED50 for this effect in the presence of 0.25 ng/ml of recombinant human TNF-alpha;, is 0.125 ug/ml.
• Endotoxin: Endotoxin level is < 0.1 ng/µg of protein (< 1 EU/µg)
• Storage: Store at -80°C.
• Stability: Stable for at least 6 months from date of receipt under proper storage and handling conditions.

Reference Data

• RefSeq: NP_001057
• Locus ID: 7133
• UniProt ID: P20333
• Cytogenetics: 1p36.22
• Refseq Size: 3682
• Refseq ORF: 1383
• Synonyms: CD120b; p75; p75TNFR; TBPII; TNF-R-II; TNF-R75; TNFBR; TNFR1B; TNFR2; TNFR80
• Summary: 'The protein encoded by this gene is a member of the TNF-receptor superfamily. This protein and TNF-receptor 1 form a heterocomplex that mediates the recruitment of two anti-apoptotic proteins, c-IAP1 and c-IAP2, which possess E3 ubiquitin ligase activity. The function of IAPs in TNF-receptor signalling is unknown, however, c-IAP1 is thought to potentiate TNF-induced apoptosis by the ubiquitination and degradation of TNF-receptor-associated factor 2, which mediates anti-apoptotic signals. Knockout studies in mice also suggest a role of this protein in protecting neurons from apoptosis by stimulating antioxidative pathways. [provided by RefSeq, Jul 2008]'
• Protein Families: Druggable Genome, Secreted Protein, Transmembrane
• Protein Pathways: Adipocytokine signaling pathway, Amyotrophic lateral sclerosis (ALS), Cytokine-cytokine receptor interaction