TNFRSF1B (NM_001066) Human Recombinant Protein
CAT#: TP723428
Purified recombinant protein of Human tumor necrosis factor receptor superfamily, member 1B (TNFRSF1B).
Specifications
Product Data | |
Species | Human |
Expression Host | E. coli |
Expression cDNA Clone or AA Sequence |
MAPEPGSTCRLREYYDQTAQMCCSKCSPGQHAKVFCTKTSDTVCDSCEDSTYTQLWNWVPECLSCGSRCSSDQVETQACTREQNRICTCRPGWYCALSKQEGCRLCAPLRKCRPGFGVARPGTETSDVVCKPCAPGTFSNTTSSTDICRPHQICNVVAIPGNASMDAVCTSTSP
|
Tag | Tag Free |
Predicted MW | 18.9 kDa |
Concentration | Resuspend the protein in the desired concentration in proper buffer |
Purity | >95% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | Lyophilized from a 0.2 µM filtered solution of 20mM phosphate buffer,100mM NaCl, pH 7.2 |
Bioactivity | Determined by its inhibitory effect of the TNF-alpha; mediated cytotoxicity in murine L-929 cells. ED50 for this effect in the presence of 0.25 ng/ml of recombinant human TNF-alpha;, is 0.125 ug/ml. |
Endotoxin | Endotoxin level is < 0.1 ng/µg of protein (< 1 EU/µg) |
Storage | Store at -80°C. |
Stability | Stable for at least 6 months from date of receipt under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_001057 |
Locus ID | 7133 |
UniProt ID | P20333 |
Cytogenetics | 1p36.22 |
Refseq Size | 3682 |
Refseq ORF | 1383 |
Synonyms | CD120b; p75; p75TNFR; TBPII; TNF-R-II; TNF-R75; TNFBR; TNFR1B; TNFR2; TNFR80 |
Summary | 'The protein encoded by this gene is a member of the TNF-receptor superfamily. This protein and TNF-receptor 1 form a heterocomplex that mediates the recruitment of two anti-apoptotic proteins, c-IAP1 and c-IAP2, which possess E3 ubiquitin ligase activity. The function of IAPs in TNF-receptor signalling is unknown, however, c-IAP1 is thought to potentiate TNF-induced apoptosis by the ubiquitination and degradation of TNF-receptor-associated factor 2, which mediates anti-apoptotic signals. Knockout studies in mice also suggest a role of this protein in protecting neurons from apoptosis by stimulating antioxidative pathways. [provided by RefSeq, Jul 2008]' |
Protein Families | Druggable Genome, Secreted Protein, Transmembrane |
Protein Pathways | Adipocytokine signaling pathway, Amyotrophic lateral sclerosis (ALS), Cytokine-cytokine receptor interaction |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC400436 | TNFRSF1B HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LY400436 | Transient overexpression lysate of tumor necrosis factor receptor superfamily, member 1B (TNFRSF1B) |
USD 325.00 |
|
TP723871 | Purified recombinant protein of Human tumor necrosis factor receptor superfamily, member 1B (sTNF-RII / TNFRSF1B) |
USD 205.00 |
{0} Product Review(s)
Be the first one to submit a review