TARC (CCL17) (NM_002987) Human Recombinant Protein
CAT#: TP723432
Purified recombinant protein of Human chemokine (C-C motif) ligand 17 (CCL17).
Specifications
Product Data | |
Species | Human |
Expression Host | E. coli |
Expression cDNA Clone or AA Sequence |
ARGTNVGRECCLEYFKGAIPLRKLKTWYQTSEDCSRDAIVFVTVQGRAICSDPNNKRVKNAVKYLQSLERS
|
Tag | Tag Free |
Predicted MW | 8 kDa |
Concentration | Resuspend the protein in the desired concentration in proper buffer |
Purity | >95% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | Lyophilized from a 0.2 µM filtered solution of 20mM phosphate buffer,100mM NaCl, pH 7.2 |
Bioactivity | Determined by its ability to chemoattract human T cells using a concentration range of 1.0-10.0 ng/ml. |
Endotoxin | Endotoxin level is < 0.1 ng/µg of protein (< 1 EU/µg) |
Storage | Store at -80°C. |
Stability | Stable for at least 6 months from date of receipt under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_002978 |
Locus ID | 6361 |
UniProt ID | Q92583 |
Cytogenetics | 16q21 |
Refseq Size | 615 |
Refseq ORF | 282 |
Synonyms | A-152E5.3; ABCD-2; SCYA17; TARC |
Summary | 'This antimicrobial gene is one of several Cys-Cys (CC) cytokine genes clustered on the q arm of chromosome 16. Cytokines are a family of secreted proteins involved in immunoregulatory and inflammatory processes. The CC cytokines are proteins characterized by two adjacent cysteines. The cytokine encoded by this gene displays chemotactic activity for T lymphocytes, but not monocytes or granulocytes. The product of this gene binds to chemokine receptors CCR4 and CCR8. This chemokine plays important roles in T cell development in thymus as well as in trafficking and activation of mature T cells. [provided by RefSeq, Sep 2014]' |
Protein Families | Druggable Genome, Secreted Protein |
Protein Pathways | Chemokine signaling pathway, Cytokine-cytokine receptor interaction |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC418971 | CCL17 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY418971 | Transient overexpression lysate of chemokine (C-C motif) ligand 17 (CCL17) |
USD 396.00 |
|
TP723729 | Purified recombinant protein of Human chemokine (C-C motif) ligand 17 (CCL17 / TARC) |
USD 170.00 |
{0} Product Review(s)
Be the first one to submit a review