TWEAKR (TNFRSF12A) (NM_016639) Human Recombinant Protein

CAT#: TP723464

Purified recombinant protein of Human tumor necrosis factor receptor superfamily, member 12A (TNFRSF12A).

Specifications

Product Data

• Species: Human
• Expression Host: E. coli
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  EQAPGTAPCSRGSSWSADLDKCMDCASCRARPHSDFCLGCAAAPPAPFRLLWP
• Tag: Tag Free
• Predicted MW: 5.6 kDa
• Concentration: Resuspend the protein in the desired concentration in proper buffer
• Purity: >95% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: Lyophilized from a 0.2 µM filtered solution of 20mM phosphate buffer,100mM NaCl, pH 7.2
• Bioactivity: Determined by its ability to inhibit TWEAK-induced weak cell death of HT29 cells. The expected ED50 for this effect is 1.0-3.0 ug/ml.
• Endotoxin: Endotoxin level is < 0.1 ng/µg of protein (< 1 EU/µg)
• Storage: Store at -80°C.
• Stability: Stable for at least 6 months from date of receipt under proper storage and handling conditions.

Reference Data

• RefSeq: NP_057723
• Locus ID: 51330
• UniProt ID: Q9NP84
• Cytogenetics: 16p13.3
• Refseq Size: 1048
• Refseq ORF: 387
• Synonyms: CD266; FN14; TWEAKR
• Protein Families: Druggable Genome, Transmembrane
• Protein Pathways: Cytokine-cytokine receptor interaction