VEGFA (NM_001033756) Human Recombinant Protein
CAT#: TP723472
Purified recombinant protein of Human vascular endothelial growth factor A (VEGFA), transcript variant 7.
Specifications
| Product Data | |
| Species | Human |
| Expression Host | E. coli |
| Expression cDNA Clone or AA Sequence |
APMAEGGGQNHHEVVKFMDVYQRSYCHPIETLVDIFQEYPDEIEYIFKPSCVPLMRCGGCCNDEGLECVPTEESNITMQIMRIKPHQGQHIGEMSFLQHNKCECRPKKDRARQENPCGPCSERRKHLFVQDPQTCKCSCKNTDSRCKARQLELNERTCRCDKPRR
|
| Tag | Tag Free |
| Predicted MW | 38.2 kDa |
| Concentration | Resuspend the protein in the desired concentration in proper buffer |
| Purity | >95% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | Lyophilized from a 0.2 µM filtered solution of 20mM phosphate buffer,100mM NaCl, pH 7.2 |
| Bioactivity | Determined by the dose-dependent stimulation of the proliferation of human umbilical vein endothelial cells (HUVEC) using a concentration range of 1.0-8.0 ng/ml. |
| Endotoxin | Endotoxin level is < 0.1 ng/µg of protein (< 1 EU/µg) |
| Storage | Store at -80°C. |
| Stability | Stable for at least 6 months from date of receipt under proper storage and handling conditions. |
| Reference Data | |
| RefSeq | NP_001028928 |
| Locus ID | 7422 |
| UniProt ID | P15692 |
| Cytogenetics | 6p21.1 |
| Refseq Size | 3476 |
| Refseq ORF | 1113 |
| Synonyms | MVCD1; VEGF; VPF |
| Summary | 'This gene is a member of the PDGF/VEGF growth factor family. It encodes a heparin-binding protein, which exists as a disulfide-linked homodimer. This growth factor induces proliferation and migration of vascular endothelial cells, and is essential for both physiological and pathological angiogenesis. Disruption of this gene in mice resulted in abnormal embryonic blood vessel formation. This gene is upregulated in many known tumors and its expression is correlated with tumor stage and progression. Elevated levels of this protein are found in patients with POEMS syndrome, also known as Crow-Fukase syndrome. Allelic variants of this gene have been associated with microvascular complications of diabetes 1 (MVCD1) and atherosclerosis. Alternatively spliced transcript variants encoding different isoforms have been described. There is also evidence for alternative translation initiation from upstream non-AUG (CUG) codons resulting in additional isoforms. A recent study showed that a C-terminally extended isoform is produced by use of an alternative in-frame translation termination codon via a stop codon readthrough mechanism, and that this isoform is antiangiogenic. Expression of some isoforms derived from the AUG start codon is regulated by a small upstream open reading frame, which is located within an internal ribosome entry site. The levels of VEGF are increased during infection with severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2), thus promoting inflammation by facilitating recruitment of inflammatory cells, and by increasing the level of angiopoietin II (Ang II), one of two products of the SARS-CoV-2 binding target, angiotensin-converting enzyme 2 (ACE2). In turn, Ang II facilitates the elevation of VEGF, thus forming a vicious cycle in the release of inflammatory cytokines. [provided by RefSeq, Jun 2020]' |
| Protein Families | Druggable Genome, Secreted Protein |
| Protein Pathways | Bladder cancer, Cytokine-cytokine receptor interaction, Focal adhesion, mTOR signaling pathway, Pancreatic cancer, Pathways in cancer, Renal cell carcinoma, VEGF signaling pathway |
Documents
| FAQs |
Resources
Recombinant Protein Resources |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC422419 | VEGFA HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
| LC422435 | VEGFA HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
| LC422439 | VEGFA HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
| LC425496 | VEGFA HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
| LC425581 | VEGFA HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
| LY422419 | Transient overexpression lysate of vascular endothelial growth factor A (VEGFA), transcript variant 7 |
USD 436.00 |
|
| LY422435 | Transient overexpression lysate of vascular endothelial growth factor A (VEGFA), transcript variant 1 |
USD 436.00 |
|
| LY422439 | Transient overexpression lysate of vascular endothelial growth factor A (VEGFA), transcript variant 6 |
USD 436.00 |
|
| LY425496 | Transient overexpression lysate of vascular endothelial growth factor A (VEGFA), transcript variant 1 |
USD 396.00 |
|
| LY425581 | Transient overexpression lysate of vascular endothelial growth factor A (VEGFA), transcript variant 7 |
USD 396.00 |
|
| TP723471 | Purified recombinant protein of Human vascular endothelial growth factor A (VEGFA), transcript variant 7. |
USD 240.00 |
|
| TP723804 | Purified recombinant protein of Human vascular endothelial growth factor A (VEGFA), transcript variant 6 |
USD 265.00 |
|
| TP723809 | Purified recombinant protein of Human vascular endothelial growth factor A (VEGFA), transcript variant 2 |
USD 265.00 |
|
| TP780001 | Recombinant protein of human Vascular endothelial growth factor A (VEGF) produced in Pichia Pastoris. |
USD 468.00 |
|
| TP780002 | Purified recombinant protein of Human vascular endothelial growth factor A (VEGFA), transcript variant 1, expressed in Pichia Pastoris, 200ug. |
USD 829.00 |
{0} Product Review(s)
Be the first one to submit a review
Germany
Japan
United Kingdom
China