VEGFD (NM_004469) Human Recombinant Protein
CAT#: TP723476
Purified recombinant protein of Human c-fos induced growth factor (vascular endothelial growth factor D) (FIGF).
Product Images
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence |
FAATFYDIETLKVIDEEWQRTQCSPRETCVEVASELGKSTNTFFKPPCVNVFRCGGCCNEESLICMNTSTSYISKQLFEISVPLTSVPELVPVKVANHTGCKCLPTAPRHPYSIIRR
|
Tag | Tag Free |
Predicted MW | 26.2 kDa |
Concentration | Resuspend the protein in the desired concentration in proper buffer |
Purity | >95% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | Lyophilized from a 0.2 µM filtered solution of 20mM phosphate buffer,100mM NaCl, pH 7.2 |
Bioactivity | Measured by its ability to bind recombinant human VEGFR3/Flt-4 Fc in a functional ELISA. |
Endotoxin | Endotoxin level is < 0.1 ng/µg of protein (< 1 EU/µg) |
Storage | Store at -80°C. |
Stability | Stable for at least 6 months from date of receipt under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_004460 |
Locus ID | 2277 |
UniProt ID | O43915 |
Cytogenetics | Xp22.2 |
Refseq Size | 2084 |
Refseq ORF | 1062 |
Synonyms | FIGF; VEGF-D |
Summary | 'The protein encoded by this gene is a member of the platelet-derived growth factor/vascular endothelial growth factor (PDGF/VEGF) family and is active in angiogenesis, lymphangiogenesis, and endothelial cell growth. This secreted protein undergoes a complex proteolytic maturation, generating multiple processed forms which bind and activate VEGFR-2 and VEGFR-3 receptors. This protein is structurally and functionally similar to vascular endothelial growth factor C. Read-through transcription has been observed between this locus and the upstream PIR (GeneID 8544) locus. [provided by RefSeq, Feb 2011]' |
Protein Families | Druggable Genome, Secreted Protein |
Protein Pathways | Bladder cancer, Cytokine-cytokine receptor interaction, Focal adhesion, mTOR signaling pathway, Pancreatic cancer, Pathways in cancer, Renal cell carcinoma |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC417969 | FIGF HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LY417969 | Transient overexpression lysate of c-fos induced growth factor (vascular endothelial growth factor D) (FIGF) |
USD 325.00 |
|
TP762029 | Purified recombinant protein of Human c-fos induced growth factor (vascular endothelial growth factor D) (FIGF),Phe89-Arg205, with N-terminal His-Trx tag, expressed in E. coli, 50ug |
USD 215.00 |
{0} Product Review(s)
Be the first one to submit a review