Vitronectin (VTN) (NM_000638) Human Recombinant Protein
CAT#: TP723478
Purified recombinant protein of Human vitronectin (VTN).
Product Images
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence |
DQESCKGRCTEGFNVDKKCQCDELCSYYQSCCTDYTAECKPQVTRGDVFTMPEDEYTVYDDGEEKNNATVHEQVGGPSLTSDLQAQSKGNPEQTPVLKPEEEAPAPEVGASKPEGIDSRPETLHPGRPQPPAEEELCSGKPFDAFTDLKNGSLFAFRGQYCYELDEKAVRPGYPKLIRDVWGIEGPIDAAFTRINCQGKTYLFKGSQYWRFEDGVLDPDYPRNISDGFDGIPDNVDAALALPAHSYSGRERVYFFKGKQYWEYQFQHQPSQEECEGSSLSAVFEHFAMMQRDSWEDIFELLFWGRTSAGTRQPQFISRDWHGVPGQVDAAMAGRIYISGMAPRPSLAKKQRFRHRNRKGYRSQRGHSRGRNQNSRRPSRATWLSLFSSEESNLGANNYDDYRMDWLVPATCEPIQSVFFFSGDKYYRVNLRTRRVDTVDPPYPRSIAQYWLGCPAPGHL
|
Tag | Tag Free |
Predicted MW | 75 kDa |
Concentration | Resuspend the protein in the desired concentration in proper buffer |
Purity | >95% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | Lyophilized from a 0.2 µM filtered solution of 20mM phosphate buffer,100mM NaCl, pH 7.2 |
Endotoxin | Endotoxin level is < 0.1 ng/µg of protein (< 1 EU/µg) |
Storage | Store at -80°C. |
Stability | Stable for at least 6 months from date of receipt under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_000629 |
Locus ID | 7448 |
UniProt ID | P04004, D9ZGG2 |
Cytogenetics | 17q11.2 |
Refseq Size | 1678 |
Refseq ORF | 1434 |
Synonyms | V75; VN; VNT |
Summary | 'The protein encoded by this gene functions in part as an adhesive glycoprotein. Differential expression of this protein can promote either cell adhesion or migration as it links cells to the extracellular matrix through a variety of ligands. These ligands include integrins, plasminogen activator inhibitor-1, and urokinase plasminogen activator receptor. This secreted protein can be present in the plasma as a monomer or dimer and forms a multimer in the extracellular matrix of several tissues. This protein also inhibits the membrane-damaging effect of the terminal cytolytic complement pathway and binds to several serpin serine protease inhibitors. This protein can also promote extracellular matrix degradation and thus plays a role in tumorigenesis. It is involved in a variety of other biological processes such as the regulation of the coagulation pathway, wound healing, and tissue remodeling. The heparin-binding domain of this protein give it anti-microbial properties. It is also a lipid binding protein that forms a principal component of high density lipoprotein. [provided by RefSeq, Aug 2020]' |
Protein Families | Druggable Genome, Secreted Protein |
Protein Pathways | ECM-receptor interaction, Focal adhesion |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC400215 | VTN HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LY400215 | Transient overexpression lysate of vitronectin (VTN) |
USD 325.00 |
|
PH302929 | VTN MS Standard C13 and N15-labeled recombinant protein (NP_000629) |
USD 2,055.00 |
|
TP302929 | Recombinant protein of human vitronectin (VTN) |
USD 439.00 |
|
TP720655 | Purified recombinant protein of Human vitronectin (VTN) |
USD 300.00 |
|
TP750077 | Purified recombinant protein of Human vitronectin (VTN), esidues 62-478aa, Tag free, expressed in E.coli, 50ug |
USD 215.00 |
|
TP790066 | Purified recombinant protein of Human vitronectin (VTN), esidues 20-478aa, with N-terminal HIS tag, secretory expressed in HEK293, 50ug |
USD 425.00 |
{0} Product Review(s)
Be the first one to submit a review