PAK1 (NM_001128620) Human Recombinant Protein

CAT#: TP723901

Purified recombinant kinase domain protein of human p21 protein (Cdc42/Rac)-activated kinase 1 (PAK1), transcript variant 1, 10 ug


  View other "PAK1" proteins (5)

USD 265.00

5 Days*

Size
    • 10 ug

Product Images

Other products for "PAK1"

Specifications

Product Data
Species Human
Expression Host E. coli
Expression cDNA Clone or AA Sequence
GPHPSDEEILEKLRSIVSVGDPKKKYTRFEKIGQGASGTVYTAMDVATGQEVAIKQMNLQQQPKKELIINEILVMRENKNPNIVNYLDSYLVGDELWVVMEYLAGGSLTDVVTETCMDEGQIAAVCRECLQALEFLHSNQVIHRDIKSDNILLGMDGSVKLTDFGFCAQITPEQSKRSTMVGTPYWMAPEVVTRKAYGPKVDIWSLGIMAIEMIEGEPPYLNENPLRALYLIATNGTPELQNPEKLSAIFRDFLNRCLEMVEKRGSAKELLQHQFLKIAKPLSSLTPLIAAAKEATKNNH
Tag Tag Free
Predicted MW 33.6 kDa
Concentration 1 mg/ml
Purity >90% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl pH 8.0, 150 mM NaCl, 10% glycerol, 5 mM DTT.
Bioactivity Specific activity was determined as 32,638 pmoles/min/µg, according to the Zlyte assay protocol
Endotoxin < 0.1 ng/µg of protein (< 1EU/µg)
Storage Store at -80°C.
Stability Stable at -80°C for 12 months from date of receipt. Protein should be thawed on ice. Protein can be flash-frozen in liquid nitrogen and stored at -80°C.
Reference Data
RefSeq NP_001122092
Locus ID 5058
UniProt ID Q13153
Cytogenetics 11q13.5-q14.1
Refseq ORF 1659
Synonyms IDDMSSD; PAKalpha
Summary 'This gene encodes a family member of serine/threonine p21-activating kinases, known as PAK proteins. These proteins are critical effectors that link RhoGTPases to cytoskeleton reorganization and nuclear signaling, and they serve as targets for the small GTP binding proteins Cdc42 and Rac. This specific family member regulates cell motility and morphology. Mutations in this gene have been associated with macrocephaly, seizures, and speech delay. Overexpression of this gene is also reported in many cancer types, and particularly in breast cancer. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Aug 2020]'
Protein Families Druggable Genome, Protein Kinase, Stem cell - Pluripotency
Protein Pathways Axon guidance, Chemokine signaling pathway, Epithelial cell signaling in Helicobacter pylori infection, ErbB signaling pathway, Fc gamma R-mediated phagocytosis, Focal adhesion, MAPK signaling pathway, Natural killer cell mediated cytotoxicity, Regulation of actin cytoskeleton, Renal cell carcinoma, T cell receptor signaling pathway

Documents

Other Versions

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.