PAK2 (NM_002577) Human Recombinant Protein

CAT#: TP723903

Purified recombinant kinase domain protein of human p21 protein (Cdc42/Rac)-activated kinase 2 (PAK2), 10 µg


  View other "PAK2" proteins (1)

USD 265.00

5 Days*

Size
    • 10 ug

Product Images

Other products for "PAK2"

Specifications

Product Data
Species Human
Expression Host E. coli
Expression cDNA Clone or AA Sequence
GPHMTDEEIMEKLRTIVSIGDPKKKYTRYEKIGQGASGTVFTATDVALGQEVAIKQINLQKQPKKELIINEILVMKELKNPNIVNFLDSYLVGDELFVVMEYLAGGSLTDVVTETCMDEAQIAAVCRECLQALEFLHANQVIHRDIKSDNVLLGMEGSVKLTDFGFCAQITPEQSKRSTMVGTPYWMAPEVVTRKAYGPKVDIWSLGIMAIEMVEGEPPYLNENPLRALYLIATNGTPELQNPEKLSPIFRDFLNRCLEMDVEKRGSAKELLQHPFLKLAKPLSSLTPLIMAAKEAMKSNR
Tag Tag Free
Predicted MW 33.5 kDa
Concentration 1 mg/ml
Purity >90% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl pH 8.0, 150 mM NaCl, 10% glycerol, 5 mM DTT.
Bioactivity Specific activity was determined as 85,806 pmoles/min/µg, according to the Zlyte assay protocol
Endotoxin < 0.1 ng/µg of protein (< 1EU/µg)
Storage Store at -80°C.
Stability Stable at -80°C for 12 months from date of receipt. Protein should be thawed on ice. Protein can be flash-frozen in liquid nitrogen and stored at -80°C.
Reference Data
RefSeq NP_002568
Locus ID 5062
UniProt ID Q13177, A8K5M4
Cytogenetics 3q29
Refseq Size 6139
Refseq ORF 1572
Synonyms PAK65; PAKgamma
Summary 'The p21 activated kinases (PAK) are critical effectors that link Rho GTPases to cytoskeleton reorganization and nuclear signaling. The PAK proteins are a family of serine/threonine kinases that serve as targets for the small GTP binding proteins, CDC42 and RAC1, and have been implicated in a wide range of biological activities. The protein encoded by this gene is activated by proteolytic cleavage during caspase-mediated apoptosis, and may play a role in regulating the apoptotic events in the dying cell. [provided by RefSeq, Jul 2008]'
Protein Families Druggable Genome, Protein Kinase
Protein Pathways Axon guidance, ErbB signaling pathway, Focal adhesion, MAPK signaling pathway, Regulation of actin cytoskeleton, Renal cell carcinoma, T cell receptor signaling pathway

Documents

Other Versions

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.