PAK2 (NM_002577) Human Recombinant Protein
CAT#: TP723903
Purified recombinant kinase domain protein of human p21 protein (Cdc42/Rac)-activated kinase 2 (PAK2), 10 µg
Other products for "PAK2"
Specifications
Product Data | |
Species | Human |
Expression Host | E. coli |
Expression cDNA Clone or AA Sequence |
GPHMTDEEIMEKLRTIVSIGDPKKKYTRYEKIGQGASGTVFTATDVALGQEVAIKQINLQKQPKKELIINEILVMKELKNPNIVNFLDSYLVGDELFVVMEYLAGGSLTDVVTETCMDEAQIAAVCRECLQALEFLHANQVIHRDIKSDNVLLGMEGSVKLTDFGFCAQITPEQSKRSTMVGTPYWMAPEVVTRKAYGPKVDIWSLGIMAIEMVEGEPPYLNENPLRALYLIATNGTPELQNPEKLSPIFRDFLNRCLEMDVEKRGSAKELLQHPFLKLAKPLSSLTPLIMAAKEAMKSNR
|
Tag | Tag Free |
Predicted MW | 33.5 kDa |
Concentration | 1 mg/ml |
Purity | >90% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl pH 8.0, 150 mM NaCl, 10% glycerol, 5 mM DTT. |
Bioactivity | Specific activity was determined as 85,806 pmoles/min/µg, according to the Zlyte assay protocol |
Endotoxin | < 0.1 ng/µg of protein (< 1EU/µg) |
Storage | Store at -80°C. |
Stability | Stable at -80°C for 12 months from date of receipt. Protein should be thawed on ice. Protein can be flash-frozen in liquid nitrogen and stored at -80°C. |
Reference Data | |
RefSeq | NP_002568 |
Locus ID | 5062 |
UniProt ID | Q13177, A8K5M4 |
Cytogenetics | 3q29 |
Refseq Size | 6139 |
Refseq ORF | 1572 |
Synonyms | PAK65; PAKgamma |
Summary | 'The p21 activated kinases (PAK) are critical effectors that link Rho GTPases to cytoskeleton reorganization and nuclear signaling. The PAK proteins are a family of serine/threonine kinases that serve as targets for the small GTP binding proteins, CDC42 and RAC1, and have been implicated in a wide range of biological activities. The protein encoded by this gene is activated by proteolytic cleavage during caspase-mediated apoptosis, and may play a role in regulating the apoptotic events in the dying cell. [provided by RefSeq, Jul 2008]' |
Protein Families | Druggable Genome, Protein Kinase |
Protein Pathways | Axon guidance, ErbB signaling pathway, Focal adhesion, MAPK signaling pathway, Regulation of actin cytoskeleton, Renal cell carcinoma, T cell receptor signaling pathway |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
TP723904 | Purified recombinant kinase domain protein of human p21 protein (Cdc42/Rac)-activated kinase 2 (PAK2), 100 µg |
USD 820.00 |
{0} Product Review(s)
0 Product Review(s)
Submit review
Be the first one to submit a review
Product Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.