PAK2 (NM_002577) Human Recombinant Protein

CAT#: TP723904

Purified recombinant kinase domain protein of human p21 protein (Cdc42/Rac)-activated kinase 2 (PAK2), 100 µg

Product Images

Specifications

Product Data

• Species: Human
• Expression Host: E. coli
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  GPHMTDEEIMEKLRTIVSIGDPKKKYTRYEKIGQGASGTVFTATDVALGQEVAIKQINLQKQPKKELIINEILVMKELKNPNIVNFLDSYLVGDELFVVMEYLAGGSLTDVVTETCMDEAQIAAVCRECLQALEFLHANQVIHRDIKSDNVLLGMEGSVKLTDFGFCAQITPEQSKRSTMVGTPYWMAPEVVTRKAYGPKVDIWSLGIMAIEMVEGEPPYLNENPLRALYLIATNGTPELQNPEKLSPIFRDFLNRCLEMDVEKRGSAKELLQHPFLKLAKPLSSLTPLIMAAKEAMKSNR
• Tag: Tag Free
• Predicted MW: 33.5 kDa
• Concentration: 1 mg/ml
• Purity: >90% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl pH 8.0, 150 mM NaCl, 10% glycerol, 5 mM DTT.
• Bioactivity: Specific activity was determined as 85,806 pmoles/min/µg, according to the Zlyte assay protocol
• Endotoxin: < 0.1 ng/µg of protein (< 1EU/µg)
• Storage: Store at -80°C.
• Stability: Stable at -80°C for 12 months from date of receipt. Protein should be thawed on ice. Protein can be flash-frozen in liquid nitrogen and stored at -80°C.

Reference Data

• RefSeq: NP_002568
• Locus ID: 5062
• UniProt ID: Q13177, A8K5M4
• Cytogenetics: 3q29
• Refseq Size: 6139
• Refseq ORF: 1572
• Synonyms: PAK65; PAKgamma
• Summary: 'The p21 activated kinases (PAK) are critical effectors that link Rho GTPases to cytoskeleton reorganization and nuclear signaling. The PAK proteins are a family of serine/threonine kinases that serve as targets for the small GTP binding proteins, CDC42 and RAC1, and have been implicated in a wide range of biological activities. The protein encoded by this gene is activated by proteolytic cleavage during caspase-mediated apoptosis, and may play a role in regulating the apoptotic events in the dying cell. [provided by RefSeq, Jul 2008]'
• Protein Families: Druggable Genome, Protein Kinase
• Protein Pathways: Axon guidance, ErbB signaling pathway, Focal adhesion, MAPK signaling pathway, Regulation of actin cytoskeleton, Renal cell carcinoma, T cell receptor signaling pathway