mStrawberry E. coli Recombinant Protein

CAT#: TP790044

Purified fluorescent protein mStrawberry, with N-terminal HIS tag, expressed in E. coli, 250ug


USD 125.00

In Stock*

Size
    • 250 ug

Product Images

Other products for "mStrawberry"

Specifications

Product Data
Species Escherichia coli
Expression Host E. coli
Expression cDNA Clone or AA Sequence
MVSKGEENNMAIIKEFMRFKVRMEGSVNGHEFEIEGEGEGRPYEGTQTAKLKVTKGGPLPFAWDILTPNFTYGSKAYVKHPADIPDYLKLSFPEGFKWERVMNFEDGGVVTVTQDSSLQDGEFIYKVKLRGTNFPSDGPVMQKKTMGWEASSERMYPEDGALKGEIKMRLKLKDGGHYDAEVKTTYKAKKPVQLPGAYIVGIKLDITSHNEDYTIVELYERAEGRHSTGGMDELYK
Tag N-His
Predicted MW 26.6 kDa
Concentration >50 ug/mL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer PBS, pH7.4, 10% glycerol.
Reference Data
RefSeq AAV52166

Documents

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.