mStrawberry E. coli Recombinant Protein
CAT#: TP790044
Purified fluorescent protein mStrawberry, with N-terminal HIS tag, expressed in E. coli, 250ug
Other products for "mStrawberry"
Specifications
Product Data | |
Species | Escherichia coli |
Expression Host | E. coli |
Expression cDNA Clone or AA Sequence |
MVSKGEENNMAIIKEFMRFKVRMEGSVNGHEFEIEGEGEGRPYEGTQTAKLKVTKGGPLPFAWDILTPNFTYGSKAYVKHPADIPDYLKLSFPEGFKWERVMNFEDGGVVTVTQDSSLQDGEFIYKVKLRGTNFPSDGPVMQKKTMGWEASSERMYPEDGALKGEIKMRLKLKDGGHYDAEVKTTYKAKKPVQLPGAYIVGIKLDITSHNEDYTIVELYERAEGRHSTGGMDELYK
|
Tag | N-His |
Predicted MW | 26.6 kDa |
Concentration | >50 ug/mL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | PBS, pH7.4, 10% glycerol. |
Reference Data | |
RefSeq | AAV52166 |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
{0} Product Review(s)
0 Product Review(s)
Submit review
Be the first one to submit a review
Product Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.