Rabbit Polyclonal Anti-MGC42174 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-MGC42174 antibody: synthetic peptide directed towards the N terminal of human MGC42174. Synthetic peptide located within the following region: WKVVKPESNDKETEAAYESDIPEELCGHHLPQQSLKSYNDSPDVIVEAQF |
Rabbit Polyclonal Anti-MGC42174 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-MGC42174 antibody: synthetic peptide directed towards the N terminal of human MGC42174. Synthetic peptide located within the following region: MSHPDYRMNLRPLGTPRGVSAVAGPHDIGASPGDKKSKNRSTRGKKKSIF |
Germany
Japan
United Kingdom
China
