DIS3L2 Rabbit Polyclonal Antibody

CAT#: TA344005

Rabbit Polyclonal Anti-MGC42174 Antibody

Product Images

WB Suggested Anti-MGC42174 Antibody Titration: 1.25 ug/ml; ELISA Titer: 1: 62500; Positive Control: Jurkat cell lysate

• 

  Rabbit Anti-MGC42174 Antibody; Paraffin Embedded Tissue: Human Heart; Cellular Data: Myocardial cells; Antibody Concentration: 4.0-8.0 ug/ml; Magnification: 400X

Specifications

Product Data

• Applications: IHC, WB
• Recommended Dilution: WB, IHC
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-MGC42174 antibody: synthetic peptide directed towards the N terminal of human MGC42174. Synthetic peptide located within the following region: WKVVKPESNDKETEAAYESDIPEELCGHHLPQQSLKSYNDSPDVIVEAQF
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Protein A purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 68 kDa
• Gene Name: DIS3 like 3'-5' exoribonuclease 2
• Database Link:
  NP_689596
  Entrez Gene 129563 Human
  UniProt ID Q8IYB7
• Background: The function remains unknown.
• Synonyms: FAM6A; hDIS3L2; PRLMNS
• Note: Immunogen Sequence Homology: Human: 100%; Pig: 93%; Bovine: 93%; Dog: 86%; Rat: 86%; Horse: 86%; Mouse: 86%; Guinea pig: 86%; Rabbit: 79%