Antibodies for $/€ 289

View as table Download

Rabbit Polyclonal Anti-C21orf7 Antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-C21orf7 antibody: synthetic peptide directed towards the C terminal of human C21orf7. Synthetic peptide located within the following region: DSEESMEVFKQHCQIAEEYHEVKKEITLLEQRKKELIAKLDQAEKEKVDA

Rabbit Polyclonal Anti-CUGBP1 Antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CUGBP1 antibody: synthetic peptide directed towards the N terminal of human CUGBP1. Synthetic peptide located within the following region: QMKPADSEKNNVEDRKLFIGMISKKCTENDIRVMFSSFGQIEECRILRGP

Rabbit Polyclonal Anti-HNRNPC Antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-HNRNPC antibody: synthetic peptide directed towards the middle region of human HNRNPC. Synthetic peptide located within the following region: ESEGGADDSAEEGDLLDDDDNEDRGDDQLELIKDDEKEAEEGEDDRDSAN

Rabbit Polyclonal Anti-KHDRBS1 Antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-KHDRBS1 antibody: synthetic peptide directed towards the middle region of human KHDRBS1. Synthetic peptide located within the following region: PPPAPETYEEYGYDDTYAEQSYEGYEGYYSQSQGDSEYYDYGHGEVQDSY

Rabbit Polyclonal Anti-Myh7 Antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-Myh7 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: TLEDQMNEHRSKAEETQRSVNDLTSQRAKLQTENGELSRQLDEKEALISQ

Rabbit Polyclonal Anti-ACTN3 Antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ACTN3 antibody: synthetic peptide directed towards the N terminal of human ACTN3. Synthetic peptide located within the following region: VQNFHTSWKDGLALCALIHRHRPDLIDYAKLRKDDPIGNLNTAFEVAEKY

ZNF500 rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human, Mouse, Rat, Zebrafish
Immunogen The immunogen for anti-ZNF500 antibody: synthetic peptide directed towards the middle region of human ZNF500.

ZNF365 rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Bovine, Canine, Human, Mouse, Rat
Immunogen The immunogen for anti-ZNF365 antibody: synthetic peptide directed towards the N terminal of human ZNF365