C21orf7 (MAP3K7CL) Rabbit Polyclonal Antibody

CAT#: TA344166

Rabbit Polyclonal Anti-C21orf7 Antibody

Product Images

Human kidney

Specifications

Product Data

• Applications: IHC
• Recommended Dilution: WB, IHC
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-C21orf7 antibody: synthetic peptide directed towards the C terminal of human C21orf7. Synthetic peptide located within the following region: DSEESMEVFKQHCQIAEEYHEVKKEITLLEQRKKELIAKLDQAEKEKVDA
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 27 kDa
• Gene Name: MAP3K7 C-terminal like
• Database Link:
  NP_064537
  Entrez Gene 56911 Human
  UniProt ID P57077
• Background: C21orf7 plays a critical role in the TGF-beta signaling transduction pathway.
• Synonyms: C21orf7; HC21ORF7; TAK1L; TAKL; TAKL-1; TAKL-2; TAKL-4
• Note: Immunogen Sequence Homology: Pig: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Dog: 93%; Horse: 93%

Reference Data

• Protein Families: Transcription Factors