Antibodies for $/€ 289

Jump to Filters
View as table Download
MASPIN (SERPINB5) Rabbit Polyclonal Antibody
TA346327

USD 410.00

5 Days

Rabbit Polyclonal Anti-SERPINB5 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SERPINB5 antibody: synthetic peptide directed towards the middle region of human SERPINB5. Synthetic peptide located within the following region: NSVNDQTKILVVNAAYFVGKWMKKFPESETKECPFRLNKTDTKPVQMMNM