MASPIN (SERPINB5) Rabbit Polyclonal Antibody

CAT#: TA346327

Rabbit Polyclonal Anti-SERPINB5 Antibody

Product Images

WB Suggested Anti-SERPINB5 Antibody Titration: 0.625 ug/ml; Positive Control: HepG2 cell lysate

• 

  Rabbit Anti-SERPINB5 Antibody; Paraffin Embedded Tissue: Human Skin; Cellular Data: Squamous epithelial cells; Antibody Concentration: 4.0-8.0 ug/ml; Magnification: 400X

Specifications

Product Data

• Applications: IHC, WB
• Recommended Dilution: WB, IHC
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-SERPINB5 antibody: synthetic peptide directed towards the middle region of human SERPINB5. Synthetic peptide located within the following region: NSVNDQTKILVVNAAYFVGKWMKKFPESETKECPFRLNKTDTKPVQMMNM
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Protein A purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 41 kDa
• Gene Name: serpin family B member 5
• Database Link:
  NP_002630
  Entrez Gene 5268 Human
  UniProt ID P36952
• Background: As a tumor suppressor, it blocks the growth, invasion, and metastatic properties of mammary tumors. As it does not undergo the S (stressed) to R (relaxed) conformational transition characteristic of active serpins, it exhibits no serine protease inhibitory activity.
• Synonyms: maspin; PI5
• Note: Immunogen Sequence Homology: Dog: 93%; Rat: 93%; Horse: 93%; Human: 93%; Pig: 86%; Mouse: 86%; Bovine: 86%; Rabbit: 86%; Guinea pig: 86%

Reference Data

• Protein Families: Druggable Genome, Secreted Protein
• Protein Pathways: p53 signaling pathway