Antibodies for $/€ 289

Jump to Filters
View as table Download
WDR8 (WRAP73) Rabbit Polyclonal Antibody
TA345999

USD 475.00

5 Days

Rabbit Polyclonal Anti-WDR8 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-WDR8 antibody: synthetic peptide directed towards the middle region of human WDR8. Synthetic peptide located within the following region: GCLSFPPPRAGAGPLPSSESKYEIASVPVSLQTLKPVTDRANPKMGIGML