Antibodies for $/€ 289

Jump to Filters
View as table Download
Estrogen Sulfotransferase (SULT1E1) Rabbit Polyclonal Antibody
TA346740

USD 475.00

5 Days

Rabbit Polyclonal Anti-SULT1E1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SULT1E1 antibody: synthetic peptide directed towards the middle region of human SULT1E1. Synthetic peptide located within the following region: LMVAGHPNPGSFPEFVEKFMQGQVPYGSWYKHVKSWWEKGKSPRVLFLFY