Estrogen Sulfotransferase (SULT1E1) Rabbit Polyclonal Antibody

CAT#: TA346740

Rabbit Polyclonal Anti-SULT1E1 Antibody


USD 475.00

5 Days*

Size
    • 100 ul

Product Images

Frequently bought together (3)
Recombinant protein of human sulfotransferase family 1E, estrogen-preferring, member 1 (SULT1E1)
    • 20 ug

USD 823.00


Transient overexpression lysate of sulfotransferase family 1E, estrogen-preferring, member 1 (SULT1E1)
    • 100 ug

USD 396.00


beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

USD 159.00

Other products for "SULT1E1"

Specifications

Product Data
Applications WB
Recommended Dilution WB
Reactivities Human
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-SULT1E1 antibody: synthetic peptide directed towards the middle region of human SULT1E1. Synthetic peptide located within the following region: LMVAGHPNPGSFPEFVEKFMQGQVPYGSWYKHVKSWWEKGKSPRVLFLFY
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Purification Affinity Purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 35
Gene Name sulfotransferase family 1E member 1
Background Sulfotransferase enzymes catalyze the sulfate conjugation of many hormones, neurotransmitters, drugs, and xenobiotic compounds. These cytosolic enzymes are different in their tissue distributions and substrate specificities. The gene structure (number and length of exons) is similar among family members. This gene encodes a protein that transfers a sulfo moiety to and from estrone, which may control levels of estrogen receptors. [provided by RefSeq, Jul 2008]
Synonyms EST; EST-1; ST1E1; STE
Note Immunogen Sequence Homology: Human: 100%; Pig: 92%; Rabbit: 92%; Guinea pig: 92%; Horse: 86%; Dog: 85%; Rat: 83%; Mouse: 83%
Reference Data
Protein Pathways Androgen and estrogen metabolism, Sulfur metabolism

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.