Estrogen Sulfotransferase (SULT1E1) Rabbit Polyclonal Antibody
Frequently bought together (3)
Recombinant protein of human sulfotransferase family 1E, estrogen-preferring, member 1 (SULT1E1)
USD 823.00
Transient overexpression lysate of sulfotransferase family 1E, estrogen-preferring, member 1 (SULT1E1)
USD 396.00
Other products for "SULT1E1"
Specifications
Product Data | |
Applications | WB |
Recommended Dilution | WB |
Reactivities | Human |
Host | Rabbit |
Isotype | IgG |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-SULT1E1 antibody: synthetic peptide directed towards the middle region of human SULT1E1. Synthetic peptide located within the following region: LMVAGHPNPGSFPEFVEKFMQGQVPYGSWYKHVKSWWEKGKSPRVLFLFY |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Purification | Affinity Purified |
Conjugation | Unconjugated |
Storage | Store at -20°C as received. |
Stability | Stable for 12 months from date of receipt. |
Predicted Protein Size | 35 |
Gene Name | sulfotransferase family 1E member 1 |
Database Link | |
Background | Sulfotransferase enzymes catalyze the sulfate conjugation of many hormones, neurotransmitters, drugs, and xenobiotic compounds. These cytosolic enzymes are different in their tissue distributions and substrate specificities. The gene structure (number and length of exons) is similar among family members. This gene encodes a protein that transfers a sulfo moiety to and from estrone, which may control levels of estrogen receptors. [provided by RefSeq, Jul 2008] |
Synonyms | EST; EST-1; ST1E1; STE |
Note | Immunogen Sequence Homology: Human: 100%; Pig: 92%; Rabbit: 92%; Guinea pig: 92%; Horse: 86%; Dog: 85%; Rat: 83%; Mouse: 83% |
Reference Data | |
Protein Pathways | Androgen and estrogen metabolism, Sulfur metabolism |
Documents
Product Manuals |
FAQs |
SDS |
{0} Product Review(s)
0 Product Review(s)
Submit review
Be the first one to submit a review
Product Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.