Rabbit Polyclonal Anti-SULT1E1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SULT1E1 antibody: synthetic peptide directed towards the middle region of human SULT1E1. Synthetic peptide located within the following region: LMVAGHPNPGSFPEFVEKFMQGQVPYGSWYKHVKSWWEKGKSPRVLFLFY |
Rabbit polyclonal anti-Estrogen Sulfotransferase antibody
| Applications | WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide surrounding amino acid 195 of human Estrogen Sulfotransferase (EST) |
SULT1E1 Rabbit polyclonal Antibody
| Applications | IF, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 140-294 of human SULT1E1 (NP_005411.1). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China
