Antibodies for $/€ 289

Jump to Filters
View as table Download
CYP4B1 Rabbit Polyclonal Antibody
TA346228

USD 475.00

5 Days

Rabbit Polyclonal Anti-Cyp4b1 Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for Anti-Cyp4b1 antibody is: synthetic peptide directed towards the C-terminal region of Mouse Cyp4b1. Synthetic peptide located within the following region: FRLYPPVPQVYRQLSKPVTFVDGRSLPAGSLISLHIYALHRNSAVWPDPE