CYP4B1 Rabbit Polyclonal Antibody

CAT#: TA346228

Rabbit Polyclonal Anti-Cyp4b1 Antibody

Product Images

Host: Rabbit; Target Name: Cyp4b1; Sample Tissue: Mouse Testis lysates; Antibody Dilution: 1.0 ug/ml

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Mouse
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-Cyp4b1 antibody is: synthetic peptide directed towards the C-terminal region of Mouse Cyp4b1. Synthetic peptide located within the following region: FRLYPPVPQVYRQLSKPVTFVDGRSLPAGSLISLHIYALHRNSAVWPDPE
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 59 kDa
• Gene Name: cytochrome P450 family 4 subfamily B member 1
• Database Link:
  NP_000770
  Entrez Gene 13120 Mouse
  UniProt ID P13584
• Background: Cyp4b1 is responsible for mutagenic activation of 3-methoxy-4-aminoazobenzene (3-MeO-AAB); a potent procarcinogen. Cyp4b1 is also active on 2-aminofluorene and 2-aminoanthracene.
• Synonyms: CYPIVB1; P-450HP
• Note: Immunogen Sequence Homology: Human: 100%; Mouse: 100%; Dog: 93%; Pig: 93%; Rat: 93%; Goat: 93%; Horse: 93%; Rabbit: 93%; Guinea pig: 93%; Bovine: 86%

Reference Data

• Protein Families: Druggable Genome, P450, Transmembrane