CYP4B1 Rabbit Polyclonal Antibody

CAT#: TA346228

Rabbit Polyclonal Anti-Cyp4b1 Antibody


USD 475.00

5 Days*

Size
    • 100 ul

Product Images

Frequently bought together (2)
Transient overexpression lysate of cytochrome P450, family 4, subfamily B, polypeptide 1 (CYP4B1), transcript variant 2
    • 100 ug

USD 325.00


beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

USD 159.00

Other products for "CYP4B1"

Specifications

Product Data
Applications WB
Recommended Dilution WB
Reactivities Mouse
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for Anti-Cyp4b1 antibody is: synthetic peptide directed towards the C-terminal region of Mouse Cyp4b1. Synthetic peptide located within the following region: FRLYPPVPQVYRQLSKPVTFVDGRSLPAGSLISLHIYALHRNSAVWPDPE
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Purification Affinity Purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 59 kDa
Gene Name cytochrome P450 family 4 subfamily B member 1
Background Cyp4b1 is responsible for mutagenic activation of 3-methoxy-4-aminoazobenzene (3-MeO-AAB); a potent procarcinogen. Cyp4b1 is also active on 2-aminofluorene and 2-aminoanthracene.
Synonyms CYPIVB1; P-450HP
Note Immunogen Sequence Homology: Human: 100%; Mouse: 100%; Dog: 93%; Pig: 93%; Rat: 93%; Goat: 93%; Horse: 93%; Rabbit: 93%; Guinea pig: 93%; Bovine: 86%
Reference Data
Protein Families Druggable Genome, P450, Transmembrane

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.