Antibodies for $/€ 289

Jump to Filters
View as table Download
Hoxc9 Rabbit Polyclonal Antibody
TA343642

USD 475.00

5 Days

Rabbit Polyclonal Anti-Hoxc9 Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for Anti-Hoxc9 antibody is: synthetic peptide directed towards the C-terminal region of Mouse Hoxc9. Synthetic peptide located within the following region: EFLFNMYLTRDRRYEVARVLNLTERQVKIWFQNRRMKMKKMNKEKTDKEQ