Antibodies for $/€ 289

Jump to Filters
View as table Download
Cib1 Rabbit Polyclonal Antibody
TA346609

USD 475.00

5 Days

Rabbit Polyclonal Anti-Cib1 Antibody

Applications WB
Reactivities Rat
Conjugation Unconjugated
Immunogen The immunogen for Anti-Cib1 antibody is: synthetic peptide directed towards the N-terminal region of Rat Cib1. Synthetic peptide located within the following region: GGSGSRLSKELLAEYQDLTFLTKQEILLAHRRFCELLPPEHRTVEESLHT