Cib1 Rabbit Polyclonal Antibody
Frequently bought together (1)
Other products for "Cib1"
Specifications
Product Data | |
Applications | WB |
Recommended Dilution | WB |
Reactivities | Rat |
Host | Rabbit |
Isotype | IgG |
Clonality | Polyclonal |
Immunogen | The immunogen for Anti-Cib1 antibody is: synthetic peptide directed towards the N-terminal region of Rat Cib1. Synthetic peptide located within the following region: GGSGSRLSKELLAEYQDLTFLTKQEILLAHRRFCELLPPEHRTVEESLHT |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Purification | Affinity Purified |
Conjugation | Unconjugated |
Storage | Store at -20°C as received. |
Stability | Stable for 12 months from date of receipt. |
Predicted Protein Size | 21 kDa |
Gene Name | calcium and integrin binding 1 |
Database Link | |
Background | interacts with both Fnk and Snk kinases [RGD, Feb 2006]. ##Evidence-Data-START## Transcript exon combination :: AF136585.1, BC091143.1 [ECO:0000332] RNAseq introns :: mixed/partial sample support ERS160522, ERS160537 [ECO:0000350] ##Evidence-Data-END## |
Synonyms | CALMYRIN; CIB; CIBP; KIP; KIP1; PRKDCIP; SIP2-28 |
Note | Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Sheep: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Horse: 93% |
Reference Data |
Documents
Product Manuals |
FAQs |
SDS |
{0} Product Review(s)
0 Product Review(s)
Submit review
Be the first one to submit a review
Product Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.