Antibodies for $/€ 289

Jump to Filters
View as table Download
GTF3C5 Rabbit Polyclonal Antibody
TA344542

USD 475.00

5 Days

Rabbit Polyclonal Anti-Gtf3c5 Antibody - middle region

Applications WB
Reactivities Rat
Conjugation Unconjugated
Immunogen The immunogen for Anti-Gtf3c5 antibody is: synthetic peptide directed towards the middle region of Rat Gtf3c5. Synthetic peptide located within the following region: IRFGYDPRKHPDAKIYQVLDFRIRCGMKYGYGSRDMPVKAKRSTYNYSLP