Antibodies for $/€ 289

Jump to Filters
View as table Download
RAB17 Rabbit Polyclonal Antibody
TA344681

USD 475.00

5 Days

Rabbit Polyclonal Anti-RAB17 Antibody - middle region

Applications WB
Reactivities Rat
Conjugation Unconjugated
Immunogen The immunogen for Anti-Rab17 antibody is: synthetic peptide directed towards the middle region of Rab17. Synthetic peptide located within the following region: HPGEVVVMLVGNKTDLGEEREVTFQEGKEFAESKSLLFMESSAKLNYQVS