RAB17 Rabbit Polyclonal Antibody

CAT#: TA344681

Rabbit Polyclonal Anti-RAB17 Antibody - middle region

Product Images

WB Suggested Anti-Rab17 Antibody; Titration: 1.0 ug/ml; Positive Control: Rat Lung

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Rat
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-Rab17 antibody is: synthetic peptide directed towards the middle region of Rab17. Synthetic peptide located within the following region: HPGEVVVMLVGNKTDLGEEREVTFQEGKEFAESKSLLFMESSAKLNYQVS
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 23 kDa
• Gene Name: RAB17, member RAS oncogene family
• Database Link:
  NP_071894
  Entrez Gene 503269 Rat
  UniProt ID Q9H0T7
• Background: The function of this protein remains unknown.
• Synonyms: FLJ12538
• Note: Immunogen Sequence Homology: Human: 100%; Dog: 93%; Rat: 93%; Mouse: 93%; Horse: 86%; Bovine: 86%; Pig: 79%; Guinea pig: 79%

Reference Data

• Protein Families: Druggable Genome