RAB17 (NM_022449) Human Recombinant Protein

CAT#: TP308378

Recombinant protein of human RAB17, member RAS oncogene family (RAB17)

Product Images

Coomassie blue staining of purified RAB17 protein (Cat# TP308378). The protein was produced from HEK293T cells transfected with RAB17 cDNA clone (Cat# RC208378) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC208378 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MAQAHRTPQPRAAPSQPRVFKLVLLGSGSVGKSSLALRYVKNDFKSILPTVGCAFFTKVVDVGATSLKLE
  IWDTAGQEKYHSVCHLYFRGANAALLVYDITRKDSFLKAQQWLKDLEEELHPGEVLVMLVGNKTDLSQER
  EVTFQEGKEFADSQKLLFMETSAKLNHQVSEVFNTVAQELLQRSDEEGQALRGDAAVALNKGPARQAKCC
  AH
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 23.3 kDa
• Concentration: >50 ug/mL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_071894
• Locus ID: 64284
• UniProt ID: Q9H0T7, A0A024R4A4
• Cytogenetics: 2q37.3
• Refseq Size: 2018
• Refseq ORF: 636
• Summary: The Rab subfamily of small GTPases plays an important role in the regulation of membrane trafficking. RAB17 is an epithelial cell-specific GTPase (Lutcke et al., 1993 [PubMed 8486736]).[supplied by OMIM, Oct 2009]
• Protein Families: Druggable Genome