RAB17 (NM_022449) Human Mass Spec Standard

CAT#: PH308378

RAB17 MS Standard C13 and N15-labeled recombinant protein (NP_071894)

Product Images

Coomassie blue staining of purified RAB17 protein (Cat# TP308378). The protein was produced from HEK293T cells transfected with RAB17 cDNA clone (Cat# RC208378) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC208378
• Predicted MW: 23.5 kDa
• Protein Sequence:
  Sequence Link

  >RC208378 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MAQAHRTPQPRAAPSQPRVFKLVLLGSGSVGKSSLALRYVKNDFKSILPTVGCAFFTKVVDVGATSLKLE
  IWDTAGQEKYHSVCHLYFRGANAALLVYDITRKDSFLKAQQWLKDLEEELHPGEVLVMLVGNKTDLSQER
  EVTFQEGKEFADSQKLLFMETSAKLNHQVSEVFNTVAQELLQRSDEEGQALRGDAAVALNKGPARQAKCC
  AH
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_071894
• RefSeq Size: 2018
• RefSeq ORF: 636
• Synonyms: FLJ12538
• Locus ID: 64284
• UniProt ID: Q9H0T7, A0A024R4A4
• Cytogenetics: 2q37.3
• Summary: The Rab subfamily of small GTPases plays an important role in the regulation of membrane trafficking. RAB17 is an epithelial cell-specific GTPase (Lutcke et al., 1993 [PubMed 8486736]). [supplied by OMIM, Oct 2009]
• Protein Families: Druggable Genome