Antibodies for $/€ 289

Jump to Filters
View as table Download
ST14 Rabbit Polyclonal Antibody
TA346508

USD 475.00

5 Days

Rabbit Polyclonal Anti-ST14 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ST14 antibody: synthetic peptide directed towards the middle region of human ST14. Synthetic peptide located within the following region: RHPGFEATFFQLPRMSSCGGRLRKAQGTFNSPYYPGHYPPNIDCTWNIEV