ST14 Rabbit Polyclonal Antibody

CAT#: TA346508

Rabbit Polyclonal Anti-ST14 Antibody

Product Images

WB Suggested Anti-ST14 Antibody Titration: 0.2-1 ug/ml; Positive Control: THP-1 cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-ST14 antibody: synthetic peptide directed towards the middle region of human ST14. Synthetic peptide located within the following region: RHPGFEATFFQLPRMSSCGGRLRKAQGTFNSPYYPGHYPPNIDCTWNIEV
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 95 kDa
• Gene Name: suppression of tumorigenicity 14
• Database Link:
  NP_068813
  Entrez Gene 6768 Human
  UniProt ID Q9Y5Y6
• Background: The protein encoded by this gene is an epithelial-derived, integral membrane serine protease. This protease forms a complex with the Kunitz-type serine protease inhibitor, HAI-1, and is found to be activated by sphingosine 1-phosphate. This protease has been shown to cleave and activate hepatocyte growth factor/scattering factor, and urokinase plasminogen activator, which suggest the function of this protease as an epithelial membrane activator for other proteases and latent growth factors. The expression of this protease has been associated with breast, colon, prostate, and ovarian tumors, which implicates its role in cancer invasion, and metastasis. [provided by RefSeq, Jul 2008]
• Synonyms: ARCI11; HAI; MT-SP1; MTSP1; PRSS14; SNC19; TADG15; TMPRSS14
• Note: Immunogen Sequence Homology: Human: 100%; Bovine: 100%; Pig: 93%; Rat: 93%; Mouse: 93%; Dog: 92%; Rabbit: 92%; Horse: 86%; Guinea pig: 79%; Zebrafish: 75%

Reference Data

• Protein Families: Druggable Genome, Protease, Transmembrane